Protein Family IF07969

Metagenome Isolate
122 Members
41 Samples
108 Scaffolds
333.84 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_158034|Ga0466718_158034_18503_19603
Length
366 aa
Sequence
MSLIILVFAVLIADTKFYCTKFVYICIIIIMKIDMRKWLNNQIAAGVKKTVPALSYSGIQLMDIKVKDIISSSDNQAKGMKLISEKVDSAAVLSLMDMSLEAECFGSEVHFSDSEVPTVVGSIVKNMEDAKKLAVPVIGTGRTLIYIEAVKKACEIIRNKPVLAGTIGPFSLAGRLTGESEAMICCYEEPEMMHTVLSKTAEFLVSYILEYKKIGANGIVIAEPAMGMLSPYLSREFSQPYMRKINDTVRDENFIVIYHNCGNVTVQMIDSILAVNADAYHFGNAIDIVEMMKYIPQNIIVMGSISPSELFHSGTPESIRKATFDLLGKCSKYPNFVISSGCDIPPLSSWKNIEAFFNAVNIYKLN

📊 Sample Types

Isolate 11.5%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.8%
Unclassified 29.3%
Kalotermitidae 12.2%
Passalidae 4.9%
Blattidae 2.4%
Hodotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
3 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
18 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
19 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
20 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 2820462123 Unclassified Firmicutes Lab288P3bin129 Isolate Unclassified
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
39 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
40 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466718_004551 3300042617 Bacteria 5520
2 Ga0466718_158034 3300042617 Bacteria 23809
3 Ga0415639_089705 3300038395 Bacteria 1790
4 Ga0466731_015564 3300042622 Bacteria 8219
5 Ga0466731_279854 3300042622 Bacteria 1592
6 Ga0123356_10001629 3300010049 Bacteria 24643
7 Ga0123356_10031174 3300010049 Bacteria 4990
8 Ga0123356_10037732 3300010049 Bacteria 4505
9 Ga0123356_10214043 3300010049 Bacteria 1978
10 Ga0123353_10164379 3300010167 Bacteria 3530
11 Ga0466694_005840 3300042594 Bacteria 106514
12 Ga0466725_072732 3300042654 Bacteria 3318
13 JGI24696J40584_12948512 3300002834 Bacteria 2010
14 Ga0466714_116463 3300042603 Bacteria 2130
15 Ga0466721_281122 3300042608 Bacteria 4857
16 Ga0123356_10078183 3300010049 Bacteria 3122
17 Ga0123356_10130833 3300010049 Bacteria 2458
18 Ga0123353_10008852 3300010167 Bacteria 13802
19 Ga0123353_10035313 3300010167 Bacteria 7815
20 Ga0123353_10155939 3300010167 Bacteria 3640
21 Ga0123354_10168930 3300010882 Bacteria 2556
22 Ga0466728_046233 3300042620 Bacteria 4489
23 Ga0415639_221222 3300038395 Bacteria 1210
24 Ga0466731_152809 3300042622 Bacteria 3404
25 IMNBL1DRAFT_c0002995 3300000062 Bacteria 11198
26 IMNBL1DRAFT_c0006814 3300000062 Bacteria 6154
27 Ga0466719_187226 3300042606 Bacteria 4493
28 Ga0466721_115030 3300042608 Unclassified 3522
29 Ga0123356_10001490 3300010049 Bacteria 25793
30 Ga0123356_10035599 3300010049 Bacteria 4650
31 Ga0123356_10103878 3300010049 Bacteria 2730
32 Ga0123356_10705414 3300010049 Bacteria 1178
33 Ga0123353_10384776 3300010167 Bacteria 2096
34 Ga0123353_10845094 3300010167 Bacteria 1256
35 Ga0466703_396655 3300042636 Bacteria 3830
36 2227588493 2225789004 Bacteria 13117
37 JGI24702J35022_10006972 3300002462 Bacteria 6496
38 Ga0466719_174794 3300042606 Bacteria 18623
39 Ga0123357_10241586 3300009784 Bacteria 1954
40 Ga0123356_10000249 3300010049 Bacteria 61743
41 Ga0123356_10000889 3300010049 Bacteria 33059
42 Ga0123356_10017743 3300010049 Bacteria 6763
43 Ga0123356_10055714 3300010049 Bacteria 3683
44 Ga0123356_10092344 3300010049 Bacteria 2886
45 Ga0123353_10201393 3300010167 Bacteria 3131
46 Ga0123353_10267417 3300010167 Unclassified 2637
47 Ga0123353_10432497 3300010167 Bacteria 1945
48 Ga0123353_10734648 3300010167 Bacteria 1377
49 Ga0466697_101674 3300042611 Bacteria 1170
50 Ga0466705_194900 3300042612 Bacteria 1319
51 Ga0415639_224545 3300038395 Bacteria 1376
52 Ga0466725_191214 3300042654 Bacteria 1569
53 Ga0466706_239136 3300042599 Bacteria 2052
54 Ga0466714_060322 3300042603 Bacteria 17353
55 Ga0466698_426282 3300042610 Bacteria 34482
56 Ga0123356_10002966 3300010049 Bacteria 17932
57 Ga0123356_10016215 3300010049 Bacteria 7115
58 Ga0123356_10017721 3300010049 Bacteria 6768
59 Ga0123356_10084886 3300010049 Bacteria 3002
60 Ga0123356_10677623 3300010049 Bacteria 1199
61 Ga0123353_10000153 3300010167 Bacteria 86738
62 Ga0123353_10108472 3300010167 Bacteria 4474
63 Ga0123353_10329516 3300010167 Bacteria 2312
64 Ga0123353_10369991 3300010167 Bacteria 2149
65 Ga0123354_10240996 3300010882 Bacteria 1860
66 Ga0466705_292812 3300042612 Bacteria 10399
67 Ga0415639_004422 3300038395 Bacteria 1902
68 Ga0415639_033618 3300038395 Bacteria 8072
69 Ga0466694_390612 3300042594 Bacteria 1329
70 Ga0466703_135325 3300042636 Bacteria 34761
71 Ga0466725_078147 3300042654 Bacteria 2829
72 Ga0466725_217932 3300042654 Bacteria 1593
73 2227646816 2225789004 Bacteria 44589
74 JGI24702J35022_10076626 3300002462 Bacteria 1807
75 JGI24705J35276_12220162 3300002504 Bacteria 2249
76 Ga0466717_313131 3300042604 Bacteria 1502
77 Ga0466721_119860 3300042608 Bacteria 7436
78 Ga0123355_10440784 3300009826 Bacteria 1649
79 Ga0123355_10543427 3300009826 Bacteria 1409
80 Ga0123356_10078817 3300010049 Bacteria 3111
81 Ga0123356_10108726 3300010049 Bacteria 2674
82 Ga0123356_10126234 3300010049 Bacteria 2498
83 Ga0123353_10049267 3300010167 Bacteria 6711
84 Ga0123353_10054511 3300010167 Bacteria 6394
85 Ga0466715_157192 3300042616 Bacteria 8008
86 Ga0415639_055795 3300038395 Bacteria 13225
87 IMNBL1DRAFT_c0000234 3300000062 Bacteria 48498
88 Ga0123357_10002030 3300009784 Bacteria 22185
89 Ga0123356_10003393 3300010049 Bacteria 16705
90 Ga0123356_10005423 3300010049 Bacteria 12980
91 Ga0123356_10077670 3300010049 Bacteria 3132
92 Ga0123356_10097447 3300010049 Bacteria 2814
93 Ga0123356_10182832 3300010049 Bacteria 2120
94 Ga0123356_10590267 3300010049 Bacteria 1275
95 Ga0123356_10830128 3300010049 Bacteria 1095
96 Ga0123353_10016188 3300010167 Bacteria 10886
97 Ga0123353_10032287 3300010167 Bacteria 8128
98 Ga0466733_111961 3300042659 Bacteria 105531
99 Ga0415639_012750 3300038395 Bacteria 6229
100 JGI24702J35022_10000965 3300002462 Bacteria 17962
101 Ga0123357_10000486 3300009784 Bacteria 38493
102 Ga0466721_400291 3300042608 Bacteria 8666
103 Ga0123356_10007874 3300010049 Bacteria 10608
104 Ga0123356_10163964 3300010049 Bacteria 2224
105 Ga0123353_10189793 3300010167 Bacteria 3245
106 Ga0123354_10039383 3300010882 Bacteria 7326
107 Ga0123354_10061245 3300010882 Bacteria 5556
108 Ga0123354_10302182 3300010882 Bacteria 1511

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_187226 Ga0466719_187226_18_884 288
2 3300010049 Ga0123356_10002966 Ga0123356_100029662 293
3 3300042617 Ga0466718_004551 Ga0466718_004551_1709_2698 299
4 3300042612 Ga0466705_194900 Ga0466705_194900_43_987 314
5 3300042611 Ga0466697_101674 Ga0466697_101674_194_1141 315
6 3300010049 Ga0123356_10084886 Ga0123356_100848864 319
7 3300010167 Ga0123353_10201393 Ga0123353_102013932 321
8 3300010882 Ga0123354_10061245 Ga0123354_100612451 322
9 3300010167 Ga0123353_10108472 Ga0123353_101084722 325
10 3300038395 Ga0415639_055795 Ga0415639_055795_2175_3152 325
11 3300042603 Ga0466714_060322 Ga0466714_060322_2380_3357 325
12 3300042599 Ga0466706_239136 Ga0466706_239136_824_1804 326
13 iso_pr_bacteria 2820277137 2820277829 327
14 3300010049 Ga0123356_10182832 Ga0123356_101828321 329
15 3300038395 Ga0415639_033618 Ga0415639_033618_4392_5381 329
16 3300042610 Ga0466698_426282 Ga0466698_426282_6705_7694 329
17 iso_pr_bacteria 2910959314 2910960928 329
18 3300002834 JGI24696J40584_12948512 JGI24696J40584_129485122 330
19 3300010049 Ga0123356_10031174 Ga0123356_100311742 330
20 3300010167 Ga0123353_10000153 Ga0123353_1000015350 330
21 3300010167 Ga0123353_10016188 Ga0123353_100161888 330
22 3300010167 Ga0123353_10054511 Ga0123353_100545116 330
23 3300010167 Ga0123353_10164379 Ga0123353_101643792 330
24 3300000062 IMNBL1DRAFT_c0006814 IMNBL1DRAFT_00068144 331
25 3300010167 Ga0123353_10035313 Ga0123353_100353135 331
26 3300038395 Ga0415639_224545 Ga0415639_224545_340_1335 331
27 3300042622 Ga0466731_015564 Ga0466731_015564_853_1848 331
28 iso_pr_bacteria 2820333861 2820335411 331
29 iso_pr_bacteria 2820563109 2820565060 331
30 3300009826 Ga0123355_10440784 Ga0123355_104407842 332
31 3300010049 Ga0123356_10007874 Ga0123356_100078748 332
32 3300010049 Ga0123356_10016215 Ga0123356_100162152 332
33 3300010049 Ga0123356_10078817 Ga0123356_100788173 332
34 3300010049 Ga0123356_10097447 Ga0123356_100974472 332
35 3300010049 Ga0123356_10108726 Ga0123356_101087262 332
36 3300010049 Ga0123356_10163964 Ga0123356_101639643 332
37 3300010049 Ga0123356_10214043 Ga0123356_102140432 332
38 3300010167 Ga0123353_10032287 Ga0123353_100322878 332
39 3300010167 Ga0123353_10329516 Ga0123353_103295162 332
40 3300010167 Ga0123353_10384776 Ga0123353_103847763 332
41 3300010167 Ga0123353_10845094 Ga0123353_108450941 332
42 3300010882 Ga0123354_10240996 Ga0123354_102409963 332
43 3300038395 Ga0415639_004422 Ga0415639_004422_479_1477 332
44 3300042608 Ga0466721_400291 Ga0466721_400291_252_1250 332
45 3300042612 Ga0466705_292812 Ga0466705_292812_9307_10305 332
46 3300042654 Ga0466725_078147 Ga0466725_078147_1357_2355 332
47 3300002504 JGI24705J35276_12220162 JGI24705J35276_122201622 333
48 3300010049 Ga0123356_10005423 Ga0123356_100054237 333
49 3300010049 Ga0123356_10035599 Ga0123356_100355993 333
50 3300010049 Ga0123356_10590267 Ga0123356_105902672 333
51 3300010049 Ga0123356_10830128 Ga0123356_108301282 333
52 3300010167 Ga0123353_10267417 Ga0123353_102674172 333
53 3300038395 Ga0415639_089705 Ga0415639_089705_435_1436 333
54 3300042622 Ga0466731_152809 Ga0466731_152809_1374_2375 333
55 3300042622 Ga0466731_279854 Ga0466731_279854_210_1211 333
56 iso_pr_bacteria 2781125629 2781262835 333
57 iso_pr_bacteria 2781125666 2781344239 333
58 iso_pr_bacteria 2781125688 2781423000 333
59 iso_pr_bacteria 2820424542 2820424909 333
60 3300009784 Ga0123357_10000486 Ga0123357_1000048610 334
61 3300009784 Ga0123357_10241586 Ga0123357_102415862 334
62 3300010049 Ga0123356_10017721 Ga0123356_100177212 334
63 3300010049 Ga0123356_10037732 Ga0123356_100377322 334
64 3300010049 Ga0123356_10055714 Ga0123356_100557142 334
65 3300010049 Ga0123356_10130833 Ga0123356_101308332 334
66 3300010167 Ga0123353_10432497 Ga0123353_104324972 334
67 3300010882 Ga0123354_10039383 Ga0123354_100393834 334
68 3300042616 Ga0466715_157192 Ga0466715_157192_6404_7408 334
69 3300042654 Ga0466725_072732 Ga0466725_072732_232_1236 334
70 3300042659 Ga0466733_111961 Ga0466733_111961_48270_49274 334
71 iso_pr_bacteria 2781125697 2781444389 334
72 3300002462 JGI24702J35022_10006972 JGI24702J35022_100069728 335
73 3300010049 Ga0123356_10003393 Ga0123356_100033933 335
74 3300010049 Ga0123356_10705414 Ga0123356_107054142 335
75 3300038395 Ga0415639_221222 Ga0415639_221222_37_1044 335
76 3300042606 Ga0466719_174794 Ga0466719_174794_753_1760 335
77 iso_pr_bacteria 2781125657 2781323307 335
78 iso_pr_bacteria 2820462123 2820463409 335
79 2225789004 2227588493 2228145258 336
80 3300009826 Ga0123355_10543427 Ga0123355_105434271 336
81 3300010049 Ga0123356_10000249 Ga0123356_1000024914 336
82 3300010049 Ga0123356_10001490 Ga0123356_100014902 336
83 3300010882 Ga0123354_10302182 Ga0123354_103021822 336
84 iso_pr_bacteria 2781125687 2781422435 336
85 2225789004 2227646816 2228239271 337
86 3300010167 Ga0123353_10049267 Ga0123353_100492672 337
87 3300010167 Ga0123353_10369991 Ga0123353_103699912 337
88 3300010882 Ga0123354_10168930 Ga0123354_101689303 337
89 3300042608 Ga0466721_281122 Ga0466721_281122_593_1606 337
90 3300010049 Ga0123356_10103878 Ga0123356_101038783 338
91 3300000062 IMNBL1DRAFT_c0000234 IMNBL1DRAFT_00002342 339
92 3300010167 Ga0123353_10008852 Ga0123353_100088522 339
93 3300042603 Ga0466714_116463 Ga0466714_116463_1058_2077 339
94 3300042620 Ga0466728_046233 Ga0466728_046233_2289_3308 339
95 3300042636 Ga0466703_135325 Ga0466703_135325_14781_15800 339
96 3300002462 JGI24702J35022_10000965 JGI24702J35022_100009656 340
97 3300042594 Ga0466694_005840 Ga0466694_005840_14616_15638 340
98 3300042654 Ga0466725_191214 Ga0466725_191214_354_1376 340
99 3300010049 Ga0123356_10017743 Ga0123356_100177434 341
100 3300010049 Ga0123356_10077670 Ga0123356_100776702 341
101 3300010049 Ga0123356_10126234 Ga0123356_101262342 341
102 3300000062 IMNBL1DRAFT_c0002995 IMNBL1DRAFT_00029952 342
103 3300010167 Ga0123353_10189793 Ga0123353_101897933 342
104 3300042594 Ga0466694_390612 Ga0466694_390612_197_1225 342
105 3300042604 Ga0466717_313131 Ga0466717_313131_106_1134 342
106 3300042608 Ga0466721_115030 Ga0466721_115030_2238_3266 342
107 3300042608 Ga0466721_119860 Ga0466721_119860_6113_7141 342
108 3300042636 Ga0466703_396655 Ga0466703_396655_1462_2490 342
109 iso_pr_bacteria 2585428085 2587834794 342
110 iso_pr_bacteria 2781125693 2781434894 342
111 3300002462 JGI24702J35022_10076626 JGI24702J35022_100766261 343
112 3300010049 Ga0123356_10000889 Ga0123356_1000088935 343
113 3300010049 Ga0123356_10078183 Ga0123356_100781831 343
114 3300010049 Ga0123356_10092344 Ga0123356_100923442 343
115 3300010049 Ga0123356_10677623 Ga0123356_106776232 343
116 3300010167 Ga0123353_10734648 Ga0123353_107346482 343
117 3300038395 Ga0415639_012750 Ga0415639_012750_2845_3879 344
118 3300010167 Ga0123353_10155939 Ga0123353_101559393 347
119 3300042654 Ga0466725_217932 Ga0466725_217932_338_1384 348
120 3300009784 Ga0123357_10002030 Ga0123357_1000203013 350
121 3300010049 Ga0123356_10001629 Ga0123356_100016298 353
122 3300042617 Ga0466718_158034 Ga0466718_158034_18503_19603 366

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D) 66 361 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.