Protein Family IF07965

Metagenome Isolate
142 Members
45 Samples
131 Scaffolds
257.63 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_156446|Ga0466718_156446_59_937
Length
292 aa
Sequence
VGTDITTTKLDVFFRNFLEIDSFAQADNSLNGIQVDNDGSSIRKIAFAVDAAMETFEQAAAAGAGMLFVHHGLFWGAPLRITGNLRRRIKFLLKCNICLYAVHLPLDQHPKMGNNACLAELLGLENIEPFGVYNGRKIGCKGVFPVPVTVEEAVKKIDFMGRPPLGVFPFGQSEIKSAAIVSGGAAKITLQAIEEGVDLFVTGEAGHQVYHDCLEGKLNMIAGGHYNTEVWGLRAVMRHCIACLGAEFGIDADFIDVPNGKKKKREYGIETFKANSPAAVINGVHYSGGSGG

📊 Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Unclassified 28.6%
Kalotermitidae 19.0%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 2
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
15 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
16 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
17 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
18 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
32 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
33 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
34 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
35 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
36 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
37 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
44 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
45 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_376636 3300042656 Bacteria 1548
2 Ga0466712_195821 3300042614 Bacteria 17019
3 Ga0466715_180881 3300042616 Bacteria 5411
4 Ga0466718_009948 3300042617 Bacteria 1389
5 Ga0466718_083308 3300042617 Bacteria 4896
6 Ga0466720_058276 3300042607 Bacteria 42688
7 Ga0466720_089732 3300042607 Unclassified 10190
8 Ga0466720_111996 3300042607 Bacteria 8578
9 Ga0466694_077836 3300042594 Bacteria 37129
10 AustNasuHG_c1013268 3300000089 Bacteria 2828
11 JGI24698J34947_10007377 3300002449 Bacteria 6045
12 JGI24698J34947_10016006 3300002449 Unclassified 4078
13 JGI24702J35022_10003326 3300002462 Bacteria 9708
14 Ga0072940_1057536 3300005200 Bacteria 5969
15 Ga0072940_1068517 3300005200 Bacteria 1662
16 Ga0466731_233896 3300042622 Bacteria 20635
17 Ga0466718_157467 3300042617 Bacteria 1496
18 Ga0466718_163457 3300042617 Unclassified 2999
19 Ga0466717_084924 3300042604 Bacteria 2045
20 Ga0466720_027935 3300042607 Bacteria 23895
21 Ga0466720_116644 3300042607 Bacteria 39029
22 Ga0466696_243494 3300042596 Bacteria 5293
23 JGI24698J34947_10001451 3300002449 Bacteria 12460
24 JGI24698J34947_10011129 3300002449 Bacteria 4937
25 JGI24698J34947_10086000 3300002449 Bacteria 1459
26 Ga0072941_1014418 3300005201 Bacteria 13817
27 Ga0466702_290156 3300042635 Bacteria 2432
28 Ga0466704_378188 3300042643 Bacteria 32721
29 Ga0466732_016065 3300042656 Bacteria 10755
30 Ga0123353_10341920 3300010167 Bacteria 2260
31 Ga0466715_048849 3300042616 Bacteria 5654
32 Ga0466718_107737 3300042617 Bacteria 57891
33 Ga0466718_131715 3300042617 Bacteria 1604
34 Ga0466720_149433 3300042607 Bacteria 6931
35 Ga0466720_159576 3300042607 Bacteria 7464
36 Ga0264413_102254 3300024493 Bacteria 3192
37 Ga0466694_129034 3300042594 Bacteria 20288
38 Ga0466699_064910 3300042597 Bacteria 2513
39 JGI24698J34947_10058444 3300002449 Bacteria 1910
40 JGI24695J34938_10000327 3300002450 Bacteria 46825
41 Ga0072941_1034213 3300005201 Bacteria 5764
42 Ga0072941_1040782 3300005201 Bacteria 3835
43 Ga0123356_10009396 3300010049 Bacteria 9659
44 Ga0123356_10160699 3300010049 Bacteria 2243
45 Ga0466712_064359 3300042614 Bacteria 30896
46 Ga0466718_010770 3300042617 Bacteria 4466
47 Ga0466718_101991 3300042617 Bacteria 3491
48 Ga0466718_146918 3300042617 Bacteria 1195
49 Ga0466700_392763 3300042600 Bacteria 2238
50 Ga0466720_075575 3300042607 Bacteria 5582
51 Ga0264413_108871 3300024493 Bacteria 3797
52 Ga0264413_134506 3300024493 Bacteria 4722
53 Ga0415639_046599 3300038395 Bacteria 7247
54 JGI24698J34947_10012911 3300002449 Bacteria 4564
55 JGI24698J34947_10032160 3300002449 Bacteria 2756
56 JGI24695J34938_10000312 3300002450 Bacteria 48010
57 Ga0072941_1038834 3300005201 Bacteria 9129
58 Ga0072941_1045615 3300005201 Bacteria 6549
59 Ga0072941_1055137 3300005201 Bacteria 7057
60 Ga0466705_086104 3300042612 Bacteria 4842
61 Ga0466702_242958 3300042635 Bacteria 12209
62 Ga0123356_10409400 3300010049 Bacteria 1495
63 Ga0123356_10869475 3300010049 Bacteria 1073
64 Ga0466712_046435 3300042614 Bacteria 1273
65 Ga0466715_008384 3300042616 Bacteria 4233
66 Ga0466690_232635 3300042590 Bacteria 21789
67 Ga0466694_077702 3300042594 Bacteria 1503
68 Ga0466695_259092 3300042595 Bacteria 134193
69 Ga0466696_079733 3300042596 Bacteria 26699
70 Ga0466699_150169 3300042597 Bacteria 2940
71 FAAS_10005258 3300001880 Bacteria 973
72 JGI24698J34947_10066954 3300002449 Archaea 1745
73 JGI24695J34938_10009112 3300002450 Bacteria 5556
74 JGI24699J35502_11131856 3300002509 Bacteria 6090
75 Ga0466702_342474 3300042635 Bacteria 3327
76 Ga0466702_452168 3300042635 Bacteria 15871
77 Ga0466709_359317 3300042648 Bacteria 12043
78 Ga0466708_110090 3300042652 Bacteria 4173
79 Ga0466712_018977 3300042614 Bacteria 23050
80 Ga0466715_409416 3300042616 Bacteria 9813
81 Ga0466718_066143 3300042617 Bacteria 4020
82 Ga0466718_077989 3300042617 Bacteria 9049
83 Ga0466718_156446 3300042617 Bacteria 1170
84 Ga0466720_009728 3300042607 Bacteria 11017
85 Ga0466720_046759 3300042607 Bacteria 24621
86 Ga0466720_112861 3300042607 Bacteria 6917
87 Ga0466722_123447 3300042609 Bacteria 25254
88 Ga0466698_237749 3300042610 Bacteria 2685
89 Ga0264413_112647 3300024493 Bacteria 24407
90 Ga0466691_058900 3300042593 Bacteria 12683
91 Ga0466694_167502 3300042594 Bacteria 3146
92 Ga0466699_003845 3300042597 Bacteria 2623
93 JGI24698J34947_10002734 3300002449 Bacteria 9534
94 JGI24695J34938_10018444 3300002450 Bacteria 3487
95 Ga0072941_1066337 3300005201 Bacteria 1966
96 Ga0072941_1100404 3300005201 Bacteria 2342
97 Ga0466731_150824 3300042622 Bacteria 1962
98 Ga0123356_10078852 3300010049 Bacteria 3110
99 Ga0466718_032850 3300042617 Bacteria 7604
100 Ga0466718_034280 3300042617 Archaea 4026
101 Ga0466718_169854 3300042617 Bacteria 5490
102 Ga0466720_120845 3300042607 Bacteria 1601
103 Ga0466694_117791 3300042594 Bacteria 4539
104 Ga0466694_290451 3300042594 Bacteria 4312
105 JGI24698J34947_10015694 3300002449 Bacteria 4120
106 JGI24698J34947_10032027 3300002449 Bacteria 2763
107 Ga0072941_1006513 3300005201 Bacteria 2511
108 Ga0072941_1020631 3300005201 Bacteria 9782
109 Ga0072941_1271783 3300005201 Bacteria 986
110 Ga0466731_071156 3300042622 Bacteria 2352
111 Ga0466732_217691 3300042656 Bacteria 3120
112 Ga0466732_240626 3300042656 Bacteria 1035
113 Ga0123356_10062570 3300010049 Bacteria 3476
114 Ga0466712_022676 3300042614 Bacteria 25093
115 Ga0466712_062031 3300042614 Bacteria 9557
116 Ga0466712_284077 3300042614 Bacteria 1443
117 Ga0466718_030506 3300042617 Bacteria 1527
118 Ga0466718_055116 3300042617 Bacteria 13015
119 Ga0466720_012964 3300042607 Bacteria 8353
120 Ga0466720_127163 3300042607 Bacteria 15897
121 Ga0466720_146539 3300042607 Bacteria 24774
122 Ga0264413_120453 3300024493 Bacteria 4549
123 Ga0466694_205754 3300042594 Bacteria 7559
124 AustNasuHG_c1020039 3300000089 Bacteria 2184
125 JGI24698J34947_10008552 3300002449 Unclassified 5618
126 JGI24698J34947_10025645 3300002449 Bacteria 3136
127 JGI24695J34938_10001759 3300002450 Bacteria 17889
128 JGI24695J34938_10032496 3300002450 Bacteria 2410
129 Ga0068305_10016636 3300005083 Bacteria 20797
130 Ga0466705_090749 3300042612 Bacteria 5471
131 Ga0466708_158543 3300042652 Bacteria 5616

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1066337 Ga0072941_10663372 236
2 3300042596 Ga0466696_079733 Ga0466696_079733_1462_2217 237
3 3300002449 JGI24698J34947_10058444 JGI24698J34947_100584444 240
4 3300002449 JGI24698J34947_10011129 JGI24698J34947_100111294 241
5 3300042594 Ga0466694_290451 Ga0466694_290451_3068_3829 243
6 3300002449 JGI24698J34947_10007377 JGI24698J34947_100073774 246
7 3300002449 JGI24698J34947_10086000 JGI24698J34947_100860002 246
8 3300002449 JGI24698J34947_10008552 JGI24698J34947_100085524 248
9 3300042590 Ga0466690_232635 Ga0466690_232635_15832_16578 248
10 3300042616 Ga0466715_409416 Ga0466715_409416_4471_5217 248
11 3300042635 Ga0466702_290156 Ga0466702_290156_1326_2072 248
12 iso_pr_bacteria 2781125637 2781281545 252
13 iso_pr_bacteria 2781125649 2781306554 252
14 3300002450 JGI24695J34938_10001759 JGI24695J34938_1000175910 253
15 iso_pr_bacteria 2781125647 2781302838 253
16 3300002449 JGI24698J34947_10016006 JGI24698J34947_100160063 254
17 3300002450 JGI24695J34938_10000327 JGI24695J34938_1000032724 254
18 3300002509 JGI24699J35502_11131856 JGI24699J35502_111318566 254
19 3300005083 Ga0068305_10016636 Ga0068305_1001663623 254
20 3300010049 Ga0123356_10078852 Ga0123356_100788522 254
21 3300010049 Ga0123356_10869475 Ga0123356_108694752 254
22 3300042635 Ga0466702_342474 Ga0466702_342474_1128_1892 254
23 3300042594 Ga0466694_077702 Ga0466694_077702_723_1490 255
24 3300042597 Ga0466699_003845 Ga0466699_003845_1705_2472 255
25 3300042610 Ga0466698_237749 Ga0466698_237749_999_1766 255
26 3300042656 Ga0466732_016065 Ga0466732_016065_3156_3923 255
27 3300010167 Ga0123353_10341920 Ga0123353_103419203 256
28 3300038395 Ga0415639_046599 Ga0415639_046599_4342_5112 256
29 3300042616 Ga0466715_008384 Ga0466715_008384_924_1694 256
30 3300042616 Ga0466715_048849 Ga0466715_048849_3825_4595 256
31 3300042635 Ga0466702_242958 Ga0466702_242958_881_1651 256
32 3300002450 JGI24695J34938_10018444 JGI24695J34938_100184442 257
33 3300002450 JGI24695J34938_10032496 JGI24695J34938_100324964 257
34 3300024493 Ga0264413_108871 Ga0264413_1088713 257
35 3300024493 Ga0264413_112647 Ga0264413_11264712 257
36 3300024493 Ga0264413_120453 Ga0264413_1204534 257
37 3300042593 Ga0466691_058900 Ga0466691_058900_1514_2287 257
38 3300042594 Ga0466694_077836 Ga0466694_077836_33886_34659 257
39 3300042594 Ga0466694_117791 Ga0466694_117791_1148_1921 257
40 3300042594 Ga0466694_129034 Ga0466694_129034_17964_18737 257
41 3300042594 Ga0466694_167502 Ga0466694_167502_374_1147 257
42 3300042594 Ga0466694_205754 Ga0466694_205754_3640_4413 257
43 3300042596 Ga0466696_243494 Ga0466696_243494_1056_1829 257
44 3300042597 Ga0466699_064910 Ga0466699_064910_841_1614 257
45 3300042600 Ga0466700_392763 Ga0466700_392763_1268_2041 257
46 3300042604 Ga0466717_084924 Ga0466717_084924_867_1640 257
47 3300042607 Ga0466720_012964 Ga0466720_012964_5749_6522 257
48 3300042607 Ga0466720_027935 Ga0466720_027935_8790_9563 257
49 3300042607 Ga0466720_058276 Ga0466720_058276_41590_42363 257
50 3300042607 Ga0466720_075575 Ga0466720_075575_4768_5541 257
51 3300042607 Ga0466720_111996 Ga0466720_111996_5452_6225 257
52 3300042607 Ga0466720_112861 Ga0466720_112861_1540_2313 257
53 3300042607 Ga0466720_116644 Ga0466720_116644_8218_8991 257
54 3300042607 Ga0466720_127163 Ga0466720_127163_13607_14380 257
55 3300042607 Ga0466720_146539 Ga0466720_146539_20446_21219 257
56 3300042607 Ga0466720_149433 Ga0466720_149433_4382_5155 257
57 3300042607 Ga0466720_159576 Ga0466720_159576_2803_3576 257
58 3300042609 Ga0466722_123447 Ga0466722_123447_18686_19459 257
59 3300042612 Ga0466705_086104 Ga0466705_086104_1939_2712 257
60 3300042612 Ga0466705_090749 Ga0466705_090749_373_1146 257
61 3300042614 Ga0466712_018977 Ga0466712_018977_2079_2852 257
62 3300042614 Ga0466712_022676 Ga0466712_022676_932_1705 257
63 3300042614 Ga0466712_062031 Ga0466712_062031_5687_6460 257
64 3300042614 Ga0466712_064359 Ga0466712_064359_2952_3725 257
65 3300042614 Ga0466712_195821 Ga0466712_195821_10650_11423 257
66 3300042614 Ga0466712_284077 Ga0466712_284077_167_940 257
67 3300042616 Ga0466715_180881 Ga0466715_180881_3348_4121 257
68 3300042617 Ga0466718_009948 Ga0466718_009948_147_920 257
69 3300042617 Ga0466718_030506 Ga0466718_030506_475_1248 257
70 3300042617 Ga0466718_055116 Ga0466718_055116_5734_6507 257
71 3300042617 Ga0466718_077989 Ga0466718_077989_3516_4289 257
72 3300042617 Ga0466718_107737 Ga0466718_107737_53799_54572 257
73 3300042617 Ga0466718_131715 Ga0466718_131715_597_1370 257
74 3300042617 Ga0466718_157467 Ga0466718_157467_456_1229 257
75 3300042617 Ga0466718_163457 Ga0466718_163457_2096_2869 257
76 3300042622 Ga0466731_071156 Ga0466731_071156_1436_2209 257
77 3300042622 Ga0466731_233896 Ga0466731_233896_4072_4845 257
78 3300042635 Ga0466702_452168 Ga0466702_452168_9782_10555 257
79 3300042643 Ga0466704_378188 Ga0466704_378188_3062_3835 257
80 3300042648 Ga0466709_359317 Ga0466709_359317_3751_4524 257
81 3300042652 Ga0466708_110090 Ga0466708_110090_2796_3569 257
82 3300042652 Ga0466708_158543 Ga0466708_158543_2051_2824 257
83 3300042656 Ga0466732_240626 Ga0466732_240626_95_868 257
84 3300042656 Ga0466732_376636 Ga0466732_376636_759_1532 257
85 iso_pr_bacteria 2781125689 2781426128 257
86 iso_pr_bacteria 2781125696 2781440190 257
87 iso_pr_bacteria 2819992462 2819993145 257
88 iso_pr_bacteria 2819994798 2819995014 257
89 3300000089 AustNasuHG_c1013268 AustNasuHG_10132682 258
90 3300000089 AustNasuHG_c1020039 AustNasuHG_10200395 258
91 3300001880 FAAS_10005258 FAAS_100052581 258
92 3300002449 JGI24698J34947_10001451 JGI24698J34947_1000145110 258
93 3300002449 JGI24698J34947_10012911 JGI24698J34947_100129116 258
94 3300002449 JGI24698J34947_10025645 JGI24698J34947_100256452 258
95 3300002449 JGI24698J34947_10032160 JGI24698J34947_100321603 258
96 3300002450 JGI24695J34938_10000312 JGI24695J34938_1000031248 258
97 3300002450 JGI24695J34938_10009112 JGI24695J34938_100091126 258
98 3300002462 JGI24702J35022_10003326 JGI24702J35022_100033264 258
99 3300005200 Ga0072940_1068517 Ga0072940_10685172 258
100 3300005201 Ga0072941_1006513 Ga0072941_10065135 258
101 3300005201 Ga0072941_1014418 Ga0072941_101441811 258
102 3300005201 Ga0072941_1020631 Ga0072941_10206314 258
103 3300005201 Ga0072941_1038834 Ga0072941_10388344 258
104 3300005201 Ga0072941_1045615 Ga0072941_10456158 258
105 3300005201 Ga0072941_1100404 Ga0072941_11004042 258
106 3300005201 Ga0072941_1271783 Ga0072941_12717831 258
107 3300010049 Ga0123356_10160699 Ga0123356_101606993 258
108 3300010049 Ga0123356_10409400 Ga0123356_104094002 258
109 3300024493 Ga0264413_102254 Ga0264413_1022542 258
110 3300042607 Ga0466720_009728 Ga0466720_009728_4933_5709 258
111 3300042607 Ga0466720_046759 Ga0466720_046759_4833_5609 258
112 3300042607 Ga0466720_120845 Ga0466720_120845_787_1563 258
113 3300042617 Ga0466718_010770 Ga0466718_010770_1524_2300 258
114 3300042617 Ga0466718_032850 Ga0466718_032850_4566_5342 258
115 3300042617 Ga0466718_066143 Ga0466718_066143_2189_2965 258
116 3300042617 Ga0466718_083308 Ga0466718_083308_845_1621 258
117 3300042595 Ga0466695_259092 Ga0466695_259092_122083_122862 259
118 3300002449 JGI24698J34947_10002734 JGI24698J34947_100027343 260
119 3300042622 Ga0466731_150824 Ga0466731_150824_439_1221 260
120 3300010049 Ga0123356_10009396 Ga0123356_100093963 261
121 3300042617 Ga0466718_034280 Ga0466718_034280_206_991 261
122 3300010049 Ga0123356_10062570 Ga0123356_100625702 262
123 3300042597 Ga0466699_150169 Ga0466699_150169_1275_2063 262
124 iso_pr_bacteria 2781125691 2781429422 262
125 3300042656 Ga0466732_217691 Ga0466732_217691_1783_2574 263
126 3300002449 JGI24698J34947_10066954 JGI24698J34947_100669543 264
127 3300005200 Ga0072940_1057536 Ga0072940_10575364 264
128 3300024493 Ga0264413_134506 Ga0264413_1345064 264
129 3300042607 Ga0466720_089732 Ga0466720_089732_4089_4883 264
130 3300042617 Ga0466718_101991 Ga0466718_101991_1687_2526 265
131 3300005201 Ga0072941_1034213 Ga0072941_10342135 266
132 3300042617 Ga0466718_146918 Ga0466718_146918_216_1052 267
133 3300042617 Ga0466718_169854 Ga0466718_169854_563_1366 267
134 3300002449 JGI24698J34947_10015694 JGI24698J34947_100156943 270
135 3300005201 Ga0072941_1040782 Ga0072941_10407822 270
136 3300042614 Ga0466712_046435 Ga0466712_046435_345_1208 270
137 3300002449 JGI24698J34947_10032027 JGI24698J34947_100320272 271
138 3300005201 Ga0072941_1055137 Ga0072941_10551376 271
139 iso_pr_bacteria 2781125651 2781309701 273
140 iso_pr_bacteria 2781125661 2781333023 273
141 iso_pr_bacteria 2781125697 2781443115 281
142 3300042617 Ga0466718_156446 Ga0466718_156446_59_937 292

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01784 DUF34_NIF3 Duf34/NIF3 (NGG1p interacting factor 3) 13 238 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.