Protein Family IF07947

Metagenome Isolate
265 Members
183 Samples
152 Scaffolds
415.85 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_124131|Ga0466718_124131_254_1645
Length
463 aa
Sequence
MCGDAYVALCLKTALTRAGNNGKILVLTFLSNPACSGHGITGNGKDFTMRRVAITGMGVVSPIGIGIQTFWQSIKEGVSGIAPITRFDASTLACRIAGEVKNYKAVDFLDHRLVQRTALFTQFAMIASQEAWNDAGLNRFTFDDPSRCGVLLGNGIGGLEVDDEAHRKLFDKGSSRIPAMTIPKMIANEAAGNVSMMLGIKGSAHVVVTACASGTDAIGFALDRIRFGRADVVLTGGAESTITEYGIGGFCQLKALSTDFNDTPHRASRPFDKNRDGFVMGEGAGILVLEEWEHAKRRGAAIYAELAGFGASADAFHLTAPSPDGEGAARAIRLALQDAGLQLEQVDYINAHGTSTPINDPIETKAIKIAFGEHAYKLAVSSTKSMTGHALGAAGGMETIITVLAIREGVFPTTLNLDEPDPECDLDYVPNKGRRGAIESALSLSLGFGGHNSVIAVKKHTER

📊 Sample Types

Isolate 42.6%
Metagenome 57.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 17.1%
Drosophilidae 14.7%
Termitidae 13.5%
Anthocoridae 8.2%
Kalotermitidae 7.6%
Apidae 6.5%
Elmidae 6.5%
Curculionidae 6.5%
Culicidae 4.1%
Armadillidiidae 3.5%
Tenebrionidae 1.8%
Hydrophilidae 1.2%
Stratiomyidae 1.2%
Rhinotermitidae 1.2%
Formicidae 1.2%
Tephritidae 1.2%
Calliphoridae 0.6%
Passalidae 0.6%
Pentatomidae 0.6%
Ceratopogonidae 0.6%
Crambidae 0.6%
Noctuidae 0.6%
Termopsidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 252
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
2 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
3 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
4 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
5 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
6 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
7 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
8 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
9 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
10 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
11 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
12 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
13 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
14 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
15 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
16 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
20 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
21 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
22 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
23 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
24 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
25 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
26 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
27 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
28 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
33 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
36 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
37 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
40 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
41 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
42 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
43 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
44 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
45 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
46 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
47 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
48 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
49 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
50 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
51 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
52 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
53 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
54 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
55 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
56 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
57 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
58 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
59 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
60 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
63 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
64 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
65 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
66 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
67 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
68 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
69 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
70 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
71 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
72 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
73 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
74 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
75 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
76 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
77 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
78 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
79 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
80 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
81 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
82 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
83 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
84 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
85 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
86 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
87 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
88 3300005313 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut Metagenome Drosophilidae
89 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
90 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
91 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
92 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
93 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
94 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
95 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
96 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
97 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
98 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
99 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
100 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
101 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
102 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
103 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
104 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
105 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
106 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
107 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
108 8100461708 Delftia sp. S65 Isolate Curculionidae
109 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
110 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
111 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
112 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
113 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
114 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
115 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
116 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
117 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
118 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
119 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
120 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
121 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
122 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
123 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
124 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
125 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
126 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
127 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
128 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
129 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
130 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
131 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
132 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
133 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
134 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
135 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
136 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
137 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
138 648276708 Pantoea sp. aB Isolate Unclassified
139 8017489919 Lactobacillus brevis EF Isolate Unclassified
140 8100455565 Delftia sp. S67 Isolate Curculionidae
141 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
142 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
143 3004719924 Lactobacillus sp. W8174 Isolate Apidae
144 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
145 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
146 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
147 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
148 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
149 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
150 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
151 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
152 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
153 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
154 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
155 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
156 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
157 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
158 8100449422 Delftia sp. S66 Isolate Curculionidae
159 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
160 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
161 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
162 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
163 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
164 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
165 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
166 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
167 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
168 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
169 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
170 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
171 8021546568 Klebsiella sp. Kps Isolate Tephritidae
172 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
173 8103002986 Erwinia sp. S38 Isolate Curculionidae
174 8103008710 Erwinia sp. S43 Isolate Curculionidae
175 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
176 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
177 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
178 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
179 3300007058 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut Metagenome Drosophilidae
180 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
181 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
182 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
183 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10001500 3300009826 Bacteria 32526
2 Ga0123356_10002820 3300010049 Bacteria 18388
3 Ga0123356_10026804 3300010049 Bacteria 5407
4 Ga0123356_10049704 3300010049 Bacteria 3903
5 Ga0123353_10001038 3300010167 Bacteria 34037
6 Ga0123353_10038567 3300010167 Bacteria 7508
7 Ga0123353_10270572 3300010167 Bacteria 2618
8 Ga0123353_10405231 3300010167 Bacteria 2028
9 Ga0160430_100367 3300012852 Bacteria 28500
10 Ga0466692_044271 3300042591 Bacteria 1330
11 Ga0466692_087582 3300042591 Bacteria 8392
12 Ga0466696_122289 3300042596 Bacteria 1518
13 Ga0466730_088042 3300042625 Bacteria 113057
14 Ga0466707_036687 3300042601 Bacteria 3753
15 Ga0466707_100121 3300042601 Bacteria 9536
16 Ga0466707_208962 3300042601 Bacteria 5886
17 Ga0466717_164695 3300042604 Bacteria 2428
18 Ga0466719_558184 3300042606 Bacteria 12938
19 Ga0466705_082072 3300042612 Bacteria 49126
20 Ga0466705_408122 3300042612 Bacteria 3349
21 Ga0466715_258969 3300042616 Bacteria 4306
22 Ga0466723_046115 3300042618 Bacteria 5327
23 Ga0466723_239264 3300042618 Bacteria 3003
24 Ga0466728_031064 3300042620 Bacteria 13389
25 Ga0466729_149901 3300042621 Bacteria 11675
26 Ga0123356_10000059 3300010049 Bacteria 117133
27 Ga0123356_10006941 3300010049 Bacteria 11371
28 Ga0123353_10451325 3300010167 Bacteria 1893
29 Ga0160443_100087 3300012848 Bacteria 160827
30 Ga0466690_330778 3300042590 Unclassified 4571
31 Ga0466693_077039 3300042592 Bacteria 3645
32 Ga0466731_377378 3300042622 Bacteria 1937
33 Ga0466703_135325 3300042636 Bacteria 34761
34 Ga0466703_275317 3300042636 Bacteria 6750
35 Ga0466724_34031 3300042649 Unclassified 1319
36 Ga0466708_240845 3300042652 Bacteria 1240
37 JGI24695J34938_10014075 3300002450 Bacteria 4166
38 Meta3P_1004596 3300002464 Unclassified 8331
39 Ga0466719_140757 3300042606 Bacteria 7816
40 Ga0466723_104311 3300042618 Bacteria 4382
41 Ga0466726_232158 3300042619 Bacteria 18939
42 Ga0123357_10053152 3300009784 Bacteria 5467
43 Ga0123355_10002038 3300009826 Bacteria 28565
44 Ga0123356_10167858 3300010049 Bacteria 2201
45 Ga0123353_10004784 3300010167 Bacteria 17567
46 Ga0123353_10027972 3300010167 Bacteria 8650
47 Ga0160453_100040 3300012814 Bacteria 158320
48 Ga0160447_101243 3300012849 Bacteria 10145
49 Ga0160435_1000236 3300012857 Bacteria 26109
50 Ga0466695_230536 3300042595 Bacteria 1425
51 Ga0466701_005097 3300042598 Unclassified 6611
52 Ga0466729_225766 3300042621 Bacteria 2797
53 Ga0466704_108183 3300042643 Bacteria 4013
54 DPO_contig03231 2032320009 Bacteria 15995
55 IMNBGM34_c003576 3300000036 Bacteria 2136
56 JGI24698J34947_10030981 3300002449 Bacteria 2818
57 JGI24702J35022_10085822 3300002462 Bacteria 1709
58 Ga0466701_074521 3300042598 Bacteria 7966
59 Ga0466701_097318 3300042598 Unclassified 15964
60 Ga0466719_102272 3300042606 Bacteria 3806
61 Ga0466705_123481 3300042612 Unclassified 3223
62 Ga0562379_0779 3300056790 Bacteria 51756
63 Ga0466723_275891 3300042618 Bacteria 1651
64 Ga0466726_164278 3300042619 Bacteria 16045
65 Ga0123356_10037223 3300010049 Bacteria 4541
66 Ga0160452_100276 3300012834 Bacteria 48547
67 Ga0160433_100010 3300012846 Bacteria 293456
68 Ga0466695_249848 3300042595 Bacteria 2476
69 Ga0466696_188110 3300042596 Bacteria 15668
70 Ga0466696_245121 3300042596 Bacteria 4906
71 Ga0466704_420691 3300042643 Bacteria 6599
72 Ga0466708_048981 3300042652 Bacteria 29674
73 Ga0466708_105411 3300042652 Bacteria 7077
74 SPBB_contig01538 2044078006 Bacteria 29469
75 JGI24695J34938_10008195 3300002450 Bacteria 5995
76 Ga0074278_132307 3300005721 Bacteria 8545
77 Ga0466701_017732 3300042598 Bacteria 17330
78 Ga0466701_046154 3300042598 Bacteria 3065
79 Ga0466717_093847 3300042604 Bacteria 11973
80 Ga0466719_241567 3300042606 Bacteria 4741
81 Ga0466705_342741 3300042612 Bacteria 3453
82 Ga0530661_002469 3300056564 Bacteria 6917
83 Ga0466715_256397 3300042616 Bacteria 48192
84 Ga0466715_450713 3300042616 Bacteria 2156
85 Ga0466723_007722 3300042618 Bacteria 5770
86 Ga0160445_100205 3300012847 Bacteria 45031
87 Ga0160443_101420 3300012848 Bacteria 8148
88 Ga0264413_113114 3300024493 Bacteria 29034
89 Ga0265387_1000010 3300024582 Bacteria 82223
90 Ga0466690_213691 3300042590 Bacteria 4139
91 Ga0466724_38768 3300042649 Bacteria 155416
92 Ga0466708_111955 3300042652 Bacteria 8192
93 JGI24696J40584_12953012 3300002834 Bacteria 2420
94 Ga0104043_1013564 3300007058 Unclassified 2732
95 Ga0104048_1000346 3300007143 Bacteria 1905
96 Ga0466701_072274 3300042598 Bacteria 8508
97 Ga0466717_010075 3300042604 Bacteria 4736
98 Ga0466717_196976 3300042604 Bacteria 1457
99 Ga0466717_206648 3300042604 Bacteria 6043
100 Ga0466711_048781 3300042615 Bacteria 12260
101 Ga0466715_467100 3300042616 Bacteria 2201
102 Ga0466729_012680 3300042621 Bacteria 4655
103 Ga0466729_118811 3300042621 Bacteria 2658
104 Ga0123357_10014061 3300009784 Bacteria 10429
105 Ga0123353_10011784 3300010167 Bacteria 12349
106 Ga0160466_100155 3300012809 Bacteria 54691
107 Ga0160469_100140 3300012824 Bacteria 86677
108 Ga0160467_100761 3300012829 Bacteria 22656
109 Ga0466699_279466 3300042597 Bacteria 4867
110 Ga0466729_318198 3300042621 Bacteria 4910
111 Ga0466730_076511 3300042625 Bacteria 5491
112 Ga0466725_331584 3300042654 Bacteria 11430
113 DPO_contig06799 2032320009 Unclassified 41801
114 CVPL010L_1000170 3300002932 Bacteria 42285
115 Ga0072940_1336870 3300005200 Bacteria 1489
116 Ga0074307_1000017 3300005313 Bacteria 1803
117 Ga0466716_182446 3300042605 Bacteria 2344
118 Ga0466732_007696 3300042656 Bacteria 4977
119 Ga0466712_175032 3300042614 Bacteria 1631
120 Ga0466711_332676 3300042615 Bacteria 1873
121 Ga0466718_124131 3300042617 Bacteria 2031
122 Ga0123353_10195134 3300010167 Bacteria 3192
123 Ga0160467_101117 3300012829 Bacteria 13587
124 Ga0160446_100042 3300012835 Bacteria 136934
125 Ga0160472_100308 3300012839 Unclassified 49704
126 Ga0160444_100078 3300012841 Bacteria 129686
127 Ga0264413_122045 3300024493 Unclassified 3105
128 Ga0466691_065155 3300042593 Bacteria 1778
129 Ga0466695_404296 3300042595 Bacteria 4054
130 Ga0466703_053637 3300042636 Bacteria 2336
131 Ga0466724_30026 3300042649 Bacteria 308356
132 DPOL_contig03341 2035918003 Bacteria 32526
133 DPOL_contig20255 2035918003 Bacteria 9889
134 Ga0466701_037076 3300042598 Bacteria 58845
135 Ga0466717_211343 3300042604 Bacteria 1613
136 Ga0466720_012040 3300042607 Bacteria 5674
137 Ga0466705_075410 3300042612 Bacteria 4094
138 Ga0466726_002227 3300042619 Bacteria 4702
139 Ga0123355_10063957 3300009826 Bacteria 5932
140 Ga0123353_10003862 3300010167 Unclassified 19126
141 Ga0123353_10397690 3300010167 Bacteria 2052
142 Ga0160454_100236 3300012798 Unclassified 54671
143 Ga0466693_414891 3300042592 Unclassified 3013
144 Ga0466694_246003 3300042594 Bacteria 6807
145 Ga0466695_113470 3300042595 Bacteria 1628
146 Ga0466696_150596 3300042596 Bacteria 5063
147 Ga0466704_233296 3300042643 Bacteria 10870
148 Ga0466724_14896 3300042649 Bacteria 6505
149 SPBB_contig00051 2044078006 Bacteria 162835
150 FGTW_contig30602 2065487013 Bacteria 14608
151 Ga0466701_062563 3300042598 Bacteria 172647
152 Ga0466720_111065 3300042607 Bacteria 1658

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2519899623 2520395548 347
2 3300042649 Ga0466724_34031 Ga0466724_34031_157_1263 368
3 iso_pr_bacteria 2781125657 2781324488 371
4 3300005313 Ga0074307_1000017 Ga0074307_10000172 372
5 3300024582 Ga0265387_1000010 Ga0265387_100001063 376
6 3300042652 Ga0466708_240845 Ga0466708_240845_40_1191 383
7 3300000036 IMNBGM34_c003576 IMNBGM34_0035762 385
8 3300042612 Ga0466705_342741 Ga0466705_342741_175_1332 385
9 3300042597 Ga0466699_279466 Ga0466699_279466_1773_2975 390
10 3300042656 Ga0466732_007696 Ga0466732_007696_807_2042 391
11 3300042596 Ga0466696_188110 Ga0466696_188110_10404_11636 392
12 3300042619 Ga0466726_232158 Ga0466726_232158_14186_15373 395
13 3300042621 Ga0466729_318198 Ga0466729_318198_2835_4034 399
14 3300042591 Ga0466692_044271 Ga0466692_044271_107_1309 400
15 3300042592 Ga0466693_414891 Ga0466693_414891_1727_2929 400
16 3300042604 Ga0466717_093847 Ga0466717_093847_1598_2800 400
17 3300042604 Ga0466717_196976 Ga0466717_196976_220_1422 400
18 3300042614 Ga0466712_175032 Ga0466712_175032_219_1421 400
19 3300005200 Ga0072940_1336870 Ga0072940_13368701 401
20 3300010167 Ga0123353_10270572 Ga0123353_102705723 401
21 3300042616 Ga0466715_256397 Ga0466715_256397_17099_18304 401
22 3300042652 Ga0466708_048981 Ga0466708_048981_19635_20840 401
23 3300042616 Ga0466715_450713 Ga0466715_450713_464_1678 404
24 3300042636 Ga0466703_053637 Ga0466703_053637_304_1518 404
25 3300010167 Ga0123353_10405231 Ga0123353_104052312 405
26 3300042596 Ga0466696_122289 Ga0466696_122289_284_1501 405
27 3300042636 Ga0466703_275317 Ga0466703_275317_1319_2536 405
28 3300042605 Ga0466716_182446 Ga0466716_182446_390_1610 406
29 iso_pr_bacteria 2902668162 2902670851 406
30 3300042590 Ga0466690_213691 Ga0466690_213691_959_2182 407
31 3300042601 Ga0466707_036687 Ga0466707_036687_2474_3721 407
32 3300042612 Ga0466705_082072 Ga0466705_082072_38213_39481 408
33 3300042621 Ga0466729_012680 Ga0466729_012680_2792_4042 408
34 iso_pr_bacteria 2896843662 2896844258 408
35 iso_pr_bacteria 8017489919 8017491784 408
36 iso_pr_bacteria 8018750880 8018751439 408
37 iso_pr_bacteria 8018754795 8018756931 408
38 iso_pr_bacteria 2820211246 2820211893 409
39 iso_pr_bacteria 2820495292 2820495718 409
40 iso_pr_bacteria 2956928875 2956930203 409
41 iso_pr_bacteria 8001918023 8001919075 409
42 3300009826 Ga0123355_10063957 Ga0123355_100639576 410
43 3300042606 Ga0466719_102272 Ga0466719_102272_1547_2779 410
44 3300042606 Ga0466719_140757 Ga0466719_140757_5536_6768 410
45 3300042612 Ga0466705_123481 Ga0466705_123481_1322_2554 410
46 iso_pr_bacteria 2576861670 2579165103 410
47 iso_pr_bacteria 2597490293 2598965261 410
48 iso_pr_bacteria 2630968413 2631703731 410
49 iso_pr_bacteria 2684622911 2686074282 410
50 iso_pr_bacteria 2690315820 2691202203 410
51 iso_pr_bacteria 2718218475 2721607993 410
52 iso_pr_bacteria 2728369362 2730150867 410
53 iso_pr_bacteria 2758568514 2760268249 410
54 iso_pr_bacteria 2770939318 2771020683 410
55 iso_pr_bacteria 2877513988 2877515552 410
56 iso_pr_bacteria 2937236879 2937237082 410
57 iso_pr_bacteria 2957623355 2957623590 410
58 iso_pr_bacteria 2960772748 2960775771 410
59 iso_pr_bacteria 2964739456 2964739564 410
60 iso_pr_bacteria 2964749277 2964749627 410
61 iso_pr_bacteria 2964765680 2964765792 410
62 iso_pr_bacteria 2964775400 2964775741 410
63 iso_pr_bacteria 2964778705 2964779055 410
64 iso_pr_bacteria 2967802344 2967802695 410
65 iso_pr_bacteria 2967825073 2967825420 410
66 iso_pr_bacteria 2970199020 2970199126 410
67 iso_pr_bacteria 2970225615 2970225814 410
68 iso_pr_bacteria 2970254690 2970254716 410
69 iso_pr_bacteria 2977592972 2977593146 410
70 iso_pr_bacteria 2977596371 2977597762 410
71 iso_pr_bacteria 2977622177 2977624095 410
72 iso_pr_bacteria 2977628635 2977628981 410
73 iso_pr_bacteria 2977635137 2977635488 410
74 iso_pr_bacteria 2977653127 2977654683 410
75 iso_pr_bacteria 3004719924 3004720832 410
76 iso_pr_bacteria 8017536074 8017537725 410
77 3300005721 Ga0074278_132307 Ga0074278_1323075 411
78 3300042616 Ga0466715_467100 Ga0466715_467100_686_1921 411
79 3300042643 Ga0466704_108183 Ga0466704_108183_65_1300 411
80 3300042652 Ga0466708_111955 Ga0466708_111955_2800_4035 411
81 iso_pr_bacteria 2820414148 2820415439 411
82 iso_pr_bacteria 2820613375 2820615014 411
83 iso_pr_bacteria 2890957088 2890958263 411
84 iso_pr_bacteria 2914375287 2914375359 411
85 3300009784 Ga0123357_10014061 Ga0123357_100140614 412
86 3300009826 Ga0123355_10002038 Ga0123355_1000203832 412
87 3300010167 Ga0123353_10038567 Ga0123353_100385678 412
88 3300042595 Ga0466695_113470 Ga0466695_113470_314_1552 412
89 3300042595 Ga0466695_230536 Ga0466695_230536_82_1320 412
90 3300042595 Ga0466695_404296 Ga0466695_404296_2299_3537 412
91 3300042604 Ga0466717_211343 Ga0466717_211343_33_1271 412
92 3300042649 Ga0466724_14896 Ga0466724_14896_506_1744 412
93 iso_pr_bacteria 2523231078 2523493689 412
94 iso_pr_bacteria 2551306396 2552919938 412
95 iso_pr_bacteria 2820180635 2820180950 412
96 iso_pr_bacteria 2820646798 2820646877 412
97 iso_pr_bacteria 2834951433 2834953496 412
98 iso_pr_bacteria 2836667214 2836669154 412
99 iso_pr_bacteria 2849099867 2849100374 412
100 iso_pr_bacteria 2849104611 2849108728 412
101 iso_pr_bacteria 2850744690 2850745314 412
102 iso_pr_bacteria 2983866074 2983868510 412
103 iso_pr_bacteria 641736255 641740654 412
104 iso_pr_bacteria 8116947750 8116949361 412
105 3300002450 JGI24695J34938_10008195 JGI24695J34938_100081953 413
106 3300009784 Ga0123357_10053152 Ga0123357_100531523 413
107 3300010049 Ga0123356_10002820 Ga0123356_100028208 413
108 3300010049 Ga0123356_10049704 Ga0123356_100497042 413
109 3300010167 Ga0123353_10003862 Ga0123353_1000386210 413
110 3300010167 Ga0123353_10195134 Ga0123353_101951341 413
111 3300010167 Ga0123353_10397690 Ga0123353_103976901 413
112 3300012834 Ga0160452_100276 Ga0160452_10027636 413
113 3300024493 Ga0264413_122045 Ga0264413_1220453 413
114 3300042590 Ga0466690_330778 Ga0466690_330778_541_1782 413
115 3300042612 Ga0466705_075410 Ga0466705_075410_2143_3384 413
116 3300042612 Ga0466705_408122 Ga0466705_408122_1551_2792 413
117 3300042615 Ga0466711_048781 Ga0466711_048781_5014_6255 413
118 3300042621 Ga0466729_149901 Ga0466729_149901_1697_2938 413
119 3300042643 Ga0466704_420691 Ga0466704_420691_2163_3404 413
120 iso_pr_bacteria 2767802234 2769332572 413
121 iso_pr_bacteria 2820178484 2820178925 413
122 iso_pr_bacteria 8030343600 8030346058 413
123 3300002462 JGI24702J35022_10085822 JGI24702J35022_100858222 414
124 3300002834 JGI24696J40584_12953012 JGI24696J40584_129530122 414
125 3300042596 Ga0466696_150596 Ga0466696_150596_1034_2278 414
126 3300042596 Ga0466696_245121 Ga0466696_245121_3502_4746 414
127 3300042604 Ga0466717_206648 Ga0466717_206648_3745_4989 414
128 3300042616 Ga0466715_258969 Ga0466715_258969_3002_4246 414
129 3300042618 Ga0466723_275891 Ga0466723_275891_178_1422 414
130 3300042619 Ga0466726_164278 Ga0466726_164278_3457_4701 414
131 3300042621 Ga0466729_225766 Ga0466729_225766_1293_2537 414
132 3300042652 Ga0466708_105411 Ga0466708_105411_1134_2378 414
133 3300010049 Ga0123356_10167858 Ga0123356_101678583 415
134 3300010167 Ga0123353_10027972 Ga0123353_100279722 415
135 3300012798 Ga0160454_100236 Ga0160454_10023638 415
136 3300012835 Ga0160446_100042 Ga0160446_10004224 415
137 3300012839 Ga0160472_100308 Ga0160472_10030832 415
138 3300012841 Ga0160444_100078 Ga0160444_10007824 415
139 3300012847 Ga0160445_100205 Ga0160445_10020520 415
140 3300042598 Ga0466701_062563 Ga0466701_062563_154768_156015 415
141 3300042601 Ga0466707_208962 Ga0466707_208962_846_2093 415
142 3300042606 Ga0466719_241567 Ga0466719_241567_3468_4715 415
143 3300042618 Ga0466723_007722 Ga0466723_007722_4458_5705 415
144 3300042618 Ga0466723_239264 Ga0466723_239264_762_2009 415
145 3300042620 Ga0466728_031064 Ga0466728_031064_10718_11965 415
146 3300042621 Ga0466729_118811 Ga0466729_118811_246_1493 415
147 3300056564 Ga0530661_002469 Ga0530661_002469_537_1784 415
148 iso_pr_bacteria 2820205024 2820206791 415
149 iso_pr_bacteria 2852431164 2852433416 415
150 3300007058 Ga0104043_1013564 Ga0104043_10135643 416
151 3300042595 Ga0466695_249848 Ga0466695_249848_566_1816 416
152 iso_pr_bacteria 2820185449 2820185574 416
153 iso_pr_bacteria 8030337018 8030338482 416
154 3300010167 Ga0123353_10011784 Ga0123353_100117847 417
155 3300042593 Ga0466691_065155 Ga0466691_065155_62_1315 417
156 3300010167 Ga0123353_10004784 Ga0123353_1000478412 418
157 3300002449 JGI24698J34947_10030981 JGI24698J34947_100309813 419
158 3300010049 Ga0123356_10026804 Ga0123356_100268043 419
159 3300042601 Ga0466707_100121 Ga0466707_100121_7612_8871 419
160 3300012829 Ga0160467_101117 Ga0160467_1011172 420
161 3300042592 Ga0466693_077039 Ga0466693_077039_668_1930 420
162 3300042604 Ga0466717_164695 Ga0466717_164695_754_2016 420
163 3300042607 Ga0466720_111065 Ga0466720_111065_342_1604 420
164 3300002450 JGI24695J34938_10014075 JGI24695J34938_100140754 421
165 3300010167 Ga0123353_10451325 Ga0123353_104513252 421
166 3300042604 Ga0466717_010075 Ga0466717_010075_3447_4712 421
167 3300042618 Ga0466723_046115 Ga0466723_046115_2194_3459 421
168 iso_pr_bacteria 2758568796 2761047704 421
169 iso_pr_bacteria 2820813074 2820813859 421
170 2032320009 DPO_contig03231 DPOB_226960 422
171 2032320009 DPO_contig06799 DPOB_190420 422
172 2035918003 DPOL_contig20255 DPOLB_1669070 422
173 2044078006 SPBB_contig00051 SPBB_600010 422
174 2044078006 SPBB_contig01538 SPBB_972050 422
175 3300012846 Ga0160433_100010 Ga0160433_10001099 422
176 3300024493 Ga0264413_113114 Ga0264413_1131147 422
177 3300042607 Ga0466720_012040 Ga0466720_012040_3570_4838 422
178 3300042618 Ga0466723_104311 Ga0466723_104311_906_2174 422
179 iso_pr_bacteria 2519899622 2520387326 422
180 iso_pr_bacteria 2864903489 2864904690 422
181 iso_pr_bacteria 2864993140 2864997186 422
182 iso_pr_bacteria 2873468275 2873472278 422
183 3300002464 Meta3P_1004596 Meta3P_10045965 423
184 3300010049 Ga0123356_10037223 Ga0123356_100372233 423
185 3300012848 Ga0160443_101420 Ga0160443_1014206 423
186 3300012852 Ga0160430_100367 Ga0160430_1003679 423
187 3300042591 Ga0466692_087582 Ga0466692_087582_4022_5293 423
188 3300042594 Ga0466694_246003 Ga0466694_246003_1070_2341 423
189 3300042598 Ga0466701_037076 Ga0466701_037076_7823_9094 423
190 3300042615 Ga0466711_332676 Ga0466711_332676_416_1687 423
191 3300042625 Ga0466730_088042 Ga0466730_088042_100615_101886 423
192 iso_pr_bacteria 2864826666 2864830804 423
193 iso_pr_bacteria 2873565274 2873570933 423
194 2035918003 DPOL_contig03341 DPOLB_1415690 424
195 2065487013 FGTW_contig30602 FGTW_01862860 424
196 3300007143 Ga0104048_1000346 Ga0104048_10003462 424
197 3300009826 Ga0123355_10001500 Ga0123355_1000150023 424
198 3300010049 Ga0123356_10006941 Ga0123356_100069418 424
199 3300042636 Ga0466703_135325 Ga0466703_135325_25446_26720 424
200 3300042654 Ga0466725_331584 Ga0466725_331584_7703_8977 424
201 iso_pr_bacteria 2588253732 2588529448 424
202 iso_pr_bacteria 2864847319 2864850579 424
203 iso_pr_bacteria 2997878596 2997884215 424
204 iso_pr_bacteria 8021540981 8021542401 424
205 iso_pr_bacteria 8021546568 8021548388 424
206 iso_pr_bacteria 8035321120 8035326082 424
207 iso_pr_bacteria 8035326735 8035328240 424
208 iso_pr_bacteria 8062647588 8062648755 424
209 3300002932 CVPL010L_1000170 CVPL010L_100017014 425
210 3300012809 Ga0160466_100155 Ga0160466_10015521 425
211 3300012829 Ga0160467_100761 Ga0160467_1007616 425
212 3300012849 Ga0160447_101243 Ga0160447_1012439 425
213 3300012857 Ga0160435_1000236 Ga0160435_10002365 425
214 iso_pr_bacteria 2681813507 2684381610 425
215 iso_pr_bacteria 2922113941 2922117397 425
216 iso_pr_bacteria 2937751072 2937751728 425
217 iso_pr_bacteria 2961206375 2961206665 425
218 iso_pr_bacteria 2961232173 2961232355 425
219 iso_pr_bacteria 2961247850 2961249164 425
220 iso_pr_bacteria 2965197371 2965201843 425
221 iso_pr_bacteria 2970791725 2970796583 425
222 iso_pr_bacteria 2996406003 2996410395 425
223 iso_pr_bacteria 2996467878 2996470868 425
224 iso_pr_bacteria 8004285568 8004288914 425
225 iso_pr_bacteria 8004307473 8004311732 425
226 iso_pr_bacteria 8004571736 8004573528 425
227 iso_pr_bacteria 8004582426 8004583285 425
228 3300012814 Ga0160453_100040 Ga0160453_10004092 426
229 3300012824 Ga0160469_100140 Ga0160469_10014040 426
230 3300012848 Ga0160443_100087 Ga0160443_10008775 426
231 3300042619 Ga0466726_002227 Ga0466726_002227_522_1802 426
232 3300056790 Ga0562379_0779 Ga0562379_0779_34283_35563 426
233 iso_pr_bacteria 2864739902 2864740759 426
234 iso_pr_bacteria 8110023836 8110025010 426
235 3300042598 Ga0466701_074521 Ga0466701_074521_6560_7843 427
236 3300042649 Ga0466724_30026 Ga0466724_30026_206470_207753 427
237 iso_pr_bacteria 2619619082 2620612896 427
238 iso_pr_bacteria 2864960361 2864962113 427
239 iso_pr_bacteria 2898991528 2898996322 427
240 iso_pr_bacteria 648276708 648770829 427
241 3300042643 Ga0466704_233296 Ga0466704_233296_5689_6975 428
242 iso_pr_bacteria 2864751016 2864751914 428
243 iso_pr_bacteria 8021535516 8021540702 428
244 3300042598 Ga0466701_005097 Ga0466701_005097_313_1602 429
245 3300042598 Ga0466701_072274 Ga0466701_072274_312_1601 429
246 3300042625 Ga0466730_076511 Ga0466730_076511_994_2283 429
247 3300042649 Ga0466724_38768 Ga0466724_38768_14643_15932 429
248 3300042598 Ga0466701_017732 Ga0466701_017732_11515_12810 431
249 3300042606 Ga0466719_558184 Ga0466719_558184_10233_11528 431
250 iso_pr_bacteria 2864745180 2864750374 431
251 iso_pr_bacteria 2864853652 2864858994 431
252 3300042598 Ga0466701_046154 Ga0466701_046154_1379_2677 432
253 iso_pr_bacteria 2990166910 2990168389 433
254 3300042598 Ga0466701_097318 Ga0466701_097318_10053_11360 435
255 iso_pr_bacteria 2873571580 2873574603 435
256 3300042622 Ga0466731_377378 Ga0466731_377378_97_1407 436
257 3300010049 Ga0123356_10000059 Ga0123356_1000005931 439
258 3300010167 Ga0123353_10001038 Ga0123353_1000103814 439
259 iso_pr_bacteria 8100449422 8100450888 441
260 iso_pr_bacteria 8100455565 8100458252 441
261 iso_pr_bacteria 8100461708 8100465981 441
262 iso_pr_bacteria 8103002986 8103004087 446
263 iso_pr_bacteria 8103008710 8103008817 446
264 iso_pr_bacteria 2864870719 2864872465 453
265 3300042617 Ga0466718_124131 Ga0466718_124131_254_1645 463

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 303 417 0.98
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 49 294 0.9
PF00108 Thiolase_N Thiolase, N-terminal domain 192 240 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00108 GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.