Protein Family IF07946
Metagenome
Isolate
116
Members
41
Samples
111
Scaffolds
120.93
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_122319|Ga0466718_122319_3244_3645
- Length
- 133 aa
- Sequence
- MQVPEKYYDEIFDFKGQWDMPSRCGLKIIRGEKIAVIVTELYQDNPGTSITAAGKSLAEQICQNKGLNINEIMYLECSPDTGSKLSFYDEEFFEVDFTSGAEPVYRQLAASEIIQISKWEKQNQPNPELCGRP
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.0%
Kalotermitidae
25.6%
Unclassified
17.9%
Rhinotermitidae
7.7%
Termopsidae
7.7%
Taxonomy
Archaea
0
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 32 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 40 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_025299 | 3300042656 | Bacteria | 3009 |
| 2 | Ga0264413_102040 | 3300024493 | Bacteria | 18121 |
| 3 | Ga0264413_118599 | 3300024493 | Bacteria | 3202 |
| 4 | Ga0466691_167043 | 3300042593 | Bacteria | 10325 |
| 5 | Ga0466715_503781 | 3300042616 | Bacteria | 29674 |
| 6 | Ga0466703_348708 | 3300042636 | Unclassified | 1790 |
| 7 | Ga0123356_12028828 | 3300010049 | Unclassified | 718 |
| 8 | Ga0466720_197193 | 3300042607 | Bacteria | 9208 |
| 9 | AustNasuHG_c1009687 | 3300000089 | Unclassified | 3375 |
| 10 | Ga0072940_1005313 | 3300005200 | Bacteria | 22551 |
| 11 | Ga0072941_1758604 | 3300005201 | Bacteria | 1117 |
| 12 | Ga0466718_094268 | 3300042617 | Bacteria | 9995 |
| 13 | Ga0466728_005858 | 3300042620 | Bacteria | 14772 |
| 14 | Ga0466735_125576 | 3300042624 | Bacteria | 3113 |
| 15 | Ga0466703_320126 | 3300042636 | Bacteria | 1531 |
| 16 | Ga0466708_060683 | 3300042652 | Bacteria | 49198 |
| 17 | Ga0123356_10000977 | 3300010049 | Bacteria | 31725 |
| 18 | Ga0123356_10002178 | 3300010049 | Bacteria | 21069 |
| 19 | Ga0466719_029723 | 3300042606 | Bacteria | 13054 |
| 20 | Ga0466720_024523 | 3300042607 | Bacteria | 19006 |
| 21 | AustNasuHG_c1005189 | 3300000089 | Bacteria | 4656 |
| 22 | AustNasuHG_c1016028 | 3300000089 | Bacteria | 2515 |
| 23 | JGI24695J34938_10002227 | 3300002450 | Bacteria | 15057 |
| 24 | Ga0074263_107052 | 3300005485 | Unclassified | 2194 |
| 25 | Ga0466699_212908 | 3300042597 | Bacteria | 27449 |
| 26 | Ga0466718_016063 | 3300042617 | Bacteria | 36821 |
| 27 | Ga0466718_045180 | 3300042617 | Unclassified | 2810 |
| 28 | Ga0466718_046313 | 3300042617 | Bacteria | 3056 |
| 29 | Ga0466729_185568 | 3300042621 | Bacteria | 1560 |
| 30 | Ga0466703_135729 | 3300042636 | Bacteria | 12462 |
| 31 | Ga0123356_10000034 | 3300010049 | Bacteria | 149865 |
| 32 | Ga0123356_10373535 | 3300010049 | Unclassified | 1556 |
| 33 | Ga0123354_10210560 | 3300010882 | Bacteria | 2102 |
| 34 | Ga0466716_347766 | 3300042605 | Bacteria | 17678 |
| 35 | Ga0466719_467643 | 3300042606 | Unclassified | 2956 |
| 36 | Ga0466720_113362 | 3300042607 | Bacteria | 5682 |
| 37 | Ga0466720_183549 | 3300042607 | Bacteria | 21136 |
| 38 | AustNasuHG_c1000213 | 3300000089 | Bacteria | 19231 |
| 39 | JGI24695J34938_10000657 | 3300002450 | Bacteria | 32770 |
| 40 | JGI24695J34938_10234892 | 3300002450 | Unclassified | 773 |
| 41 | JGI24695J34938_10429571 | 3300002450 | Unclassified | 594 |
| 42 | Ga0068302_10111791 | 3300005071 | Bacteria | 7696 |
| 43 | Ga0074263_123091 | 3300005485 | Unclassified | 891 |
| 44 | Ga0466697_057313 | 3300042611 | Bacteria | 1604 |
| 45 | Ga0264413_107726 | 3300024493 | Bacteria | 7599 |
| 46 | Ga0466696_418204 | 3300042596 | Bacteria | 5514 |
| 47 | Ga0466711_272661 | 3300042615 | Bacteria | 4675 |
| 48 | Ga0466718_080120 | 3300042617 | Bacteria | 1494 |
| 49 | Ga0466718_122256 | 3300042617 | Bacteria | 26403 |
| 50 | Ga0466728_007874 | 3300042620 | Bacteria | 4820 |
| 51 | Ga0466728_278714 | 3300042620 | Bacteria | 5281 |
| 52 | Ga0123356_10458613 | 3300010049 | Bacteria | 1424 |
| 53 | AustNasuHG_c1000258 | 3300000089 | Bacteria | 18022 |
| 54 | JGI24695J34938_10404988 | 3300002450 | Unclassified | 609 |
| 55 | Ga0074263_100133 | 3300005485 | Bacteria | 2173 |
| 56 | Ga0264413_107804 | 3300024493 | Bacteria | 18094 |
| 57 | Ga0466690_060592 | 3300042590 | Bacteria | 15805 |
| 58 | Ga0466690_400861 | 3300042590 | Bacteria | 1646 |
| 59 | Ga0466691_172457 | 3300042593 | Bacteria | 4094 |
| 60 | Ga0466711_394852 | 3300042615 | Bacteria | 15895 |
| 61 | Ga0466715_317829 | 3300042616 | Bacteria | 29367 |
| 62 | Ga0466726_048716 | 3300042619 | Bacteria | 3996 |
| 63 | Ga0466713_092950 | 3300042602 | Bacteria | 117604 |
| 64 | Ga0466720_142258 | 3300042607 | Bacteria | 17236 |
| 65 | Ga0466720_172607 | 3300042607 | Bacteria | 2091 |
| 66 | Ga0466720_217425 | 3300042607 | Bacteria | 21579 |
| 67 | Ga0466720_230109 | 3300042607 | Bacteria | 6285 |
| 68 | AustNasuHG_c1002306 | 3300000089 | Bacteria | 6887 |
| 69 | AustNasuHG_c1004858 | 3300000089 | Bacteria | 4811 |
| 70 | AustNasuHG_c1011147 | 3300000089 | Bacteria | 3119 |
| 71 | JGI24695J34938_10075037 | 3300002450 | Unclassified | 1405 |
| 72 | Ga0072941_1076083 | 3300005201 | Bacteria | 2265 |
| 73 | Ga0466692_034249 | 3300042591 | Bacteria | 1356 |
| 74 | Ga0466693_074463 | 3300042592 | Bacteria | 52718 |
| 75 | Ga0466718_017022 | 3300042617 | Bacteria | 5077 |
| 76 | Ga0466718_119015 | 3300042617 | Bacteria | 1197 |
| 77 | Ga0466703_065243 | 3300042636 | Bacteria | 10132 |
| 78 | Ga0123356_10007980 | 3300010049 | Bacteria | 10535 |
| 79 | Ga0123356_10062141 | 3300010049 | Bacteria | 3488 |
| 80 | Ga0466720_051968 | 3300042607 | Bacteria | 35380 |
| 81 | Ga0466722_253167 | 3300042609 | Bacteria | 5595 |
| 82 | Nasutiter_Contig00460 | 2030936001 | Bacteria | 2100 |
| 83 | JGI24695J34938_10000611 | 3300002450 | Bacteria | 34277 |
| 84 | JGI24695J34938_10237105 | 3300002450 | Bacteria | 770 |
| 85 | Ga0264413_101700 | 3300024493 | Bacteria | 8378 |
| 86 | Ga0264413_103070 | 3300024493 | Bacteria | 25813 |
| 87 | Ga0466690_313164 | 3300042590 | Bacteria | 2366 |
| 88 | Ga0466718_018949 | 3300042617 | Bacteria | 6601 |
| 89 | Ga0466718_027705 | 3300042617 | Bacteria | 21984 |
| 90 | Ga0466718_031990 | 3300042617 | Bacteria | 2548 |
| 91 | Ga0466718_063326 | 3300042617 | Bacteria | 1709 |
| 92 | Ga0466718_118023 | 3300042617 | Bacteria | 19941 |
| 93 | Ga0466708_130167 | 3300042652 | Bacteria | 53436 |
| 94 | Ga0466707_276910 | 3300042601 | Bacteria | 1317 |
| 95 | Ga0466713_007535 | 3300042602 | Bacteria | 1538 |
| 96 | Ga0466717_173403 | 3300042604 | Bacteria | 2686 |
| 97 | Ga0466722_073931 | 3300042609 | Bacteria | 4048 |
| 98 | JGI24698J34947_10000471 | 3300002449 | Bacteria | 18816 |
| 99 | JGI24705J35276_11989484 | 3300002504 | Bacteria | 835 |
| 100 | Ga0264413_109391 | 3300024493 | Bacteria | 2038 |
| 101 | Ga0264413_114604 | 3300024493 | Bacteria | 5172 |
| 102 | Ga0466715_386829 | 3300042616 | Bacteria | 8408 |
| 103 | Ga0466718_122319 | 3300042617 | Bacteria | 7879 |
| 104 | Ga0466728_450661 | 3300042620 | Unclassified | 7822 |
| 105 | Ga0123354_10094817 | 3300010882 | Unclassified | 4090 |
| 106 | Ga0466716_257662 | 3300042605 | Bacteria | 29731 |
| 107 | Ga0466720_100261 | 3300042607 | Bacteria | 14659 |
| 108 | AustNasuHG_c1003874 | 3300000089 | Bacteria | 5389 |
| 109 | JGI24695J34938_10027576 | 3300002450 | Bacteria | 2683 |
| 110 | Ga0072940_1058989 | 3300005200 | Bacteria | 2711 |
| 111 | Ga0074263_109306 | 3300005485 | Bacteria | 2517 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042606 | Ga0466719_467643 | Ga0466719_467643_75_377 | 100 |
| 2 | 3300005485 | Ga0074263_123091 | Ga0074263_1230912 | 112 |
| 3 | 2030936001 | Nasutiter_Contig00460 | Nasutiterm_843130 | 114 |
| 4 | 3300005200 | Ga0072940_1005313 | Ga0072940_100531310 | 115 |
| 5 | 3300024493 | Ga0264413_107726 | Ga0264413_1077264 | 115 |
| 6 | 3300042597 | Ga0466699_212908 | Ga0466699_212908_11517_11864 | 115 |
| 7 | 3300042607 | Ga0466720_100261 | Ga0466720_100261_10450_10797 | 115 |
| 8 | 3300042607 | Ga0466720_217425 | Ga0466720_217425_3686_4033 | 115 |
| 9 | 3300042607 | Ga0466720_230109 | Ga0466720_230109_687_1034 | 115 |
| 10 | 3300042617 | Ga0466718_046313 | Ga0466718_046313_726_1073 | 115 |
| 11 | 3300005485 | Ga0074263_107052 | Ga0074263_1070522 | 116 |
| 12 | 3300042607 | Ga0466720_024523 | Ga0466720_024523_13408_13758 | 116 |
| 13 | 3300042609 | Ga0466722_073931 | Ga0466722_073931_2823_3173 | 116 |
| 14 | 3300005485 | Ga0074263_100133 | Ga0074263_1001332 | 117 |
| 15 | 3300024493 | Ga0264413_101700 | Ga0264413_1017009 | 117 |
| 16 | 3300024493 | Ga0264413_109391 | Ga0264413_1093913 | 117 |
| 17 | 3300024493 | Ga0264413_114604 | Ga0264413_1146046 | 117 |
| 18 | 3300024493 | Ga0264413_118599 | Ga0264413_1185992 | 117 |
| 19 | 3300042607 | Ga0466720_051968 | Ga0466720_051968_14820_15173 | 117 |
| 20 | 3300042607 | Ga0466720_113362 | Ga0466720_113362_1973_2326 | 117 |
| 21 | 3300042607 | Ga0466720_183549 | Ga0466720_183549_12673_13026 | 117 |
| 22 | 3300042617 | Ga0466718_027705 | Ga0466718_027705_4035_4388 | 117 |
| 23 | 3300042636 | Ga0466703_348708 | Ga0466703_348708_609_962 | 117 |
| 24 | iso_pr_bacteria | 2781125657 | 2781322396 | 117 |
| 25 | iso_pr_bacteria | 2781125659 | 2781328038 | 117 |
| 26 | iso_pr_bacteria | 2781125664 | 2781339391 | 117 |
| 27 | iso_pr_bacteria | 2781125665 | 2781342376 | 117 |
| 28 | 3300002450 | JGI24695J34938_10000657 | JGI24695J34938_1000065729 | 118 |
| 29 | 3300010049 | Ga0123356_10000034 | Ga0123356_1000003416 | 118 |
| 30 | 3300010049 | Ga0123356_10000977 | Ga0123356_1000097722 | 118 |
| 31 | 3300010049 | Ga0123356_10002178 | Ga0123356_1000217814 | 118 |
| 32 | 3300010049 | Ga0123356_10007980 | Ga0123356_1000798010 | 118 |
| 33 | 3300010049 | Ga0123356_10062141 | Ga0123356_100621413 | 118 |
| 34 | 3300010049 | Ga0123356_12028828 | Ga0123356_120288282 | 118 |
| 35 | 3300042602 | Ga0466713_092950 | Ga0466713_092950_96274_96630 | 118 |
| 36 | 3300042609 | Ga0466722_253167 | Ga0466722_253167_1062_1418 | 118 |
| 37 | 3300042620 | Ga0466728_278714 | Ga0466728_278714_2350_2706 | 118 |
| 38 | 3300005201 | Ga0072941_1076083 | Ga0072941_10760833 | 119 |
| 39 | 3300010049 | Ga0123356_10373535 | Ga0123356_103735352 | 119 |
| 40 | 3300042611 | Ga0466697_057313 | Ga0466697_057313_55_414 | 119 |
| 41 | 3300042620 | Ga0466728_450661 | Ga0466728_450661_4452_4811 | 119 |
| 42 | 3300042636 | Ga0466703_065243 | Ga0466703_065243_8422_8781 | 119 |
| 43 | 3300042636 | Ga0466703_320126 | Ga0466703_320126_437_796 | 119 |
| 44 | 3300000089 | AustNasuHG_c1000258 | AustNasuHG_100025814 | 120 |
| 45 | 3300002450 | JGI24695J34938_10075037 | JGI24695J34938_100750372 | 120 |
| 46 | 3300002504 | JGI24705J35276_11989484 | JGI24705J35276_119894842 | 120 |
| 47 | 3300010049 | Ga0123356_10458613 | Ga0123356_104586132 | 120 |
| 48 | 3300010882 | Ga0123354_10094817 | Ga0123354_100948172 | 120 |
| 49 | 3300010882 | Ga0123354_10210560 | Ga0123354_102105603 | 120 |
| 50 | 3300042593 | Ga0466691_172457 | Ga0466691_172457_222_584 | 120 |
| 51 | 3300042607 | Ga0466720_197193 | Ga0466720_197193_4345_4707 | 120 |
| 52 | 3300042615 | Ga0466711_272661 | Ga0466711_272661_3775_4137 | 120 |
| 53 | 3300042617 | Ga0466718_017022 | Ga0466718_017022_4187_4549 | 120 |
| 54 | 3300042617 | Ga0466718_094268 | Ga0466718_094268_1736_2098 | 120 |
| 55 | 3300042656 | Ga0466732_025299 | Ga0466732_025299_159_521 | 120 |
| 56 | 3300000089 | AustNasuHG_c1004858 | AustNasuHG_10048584 | 121 |
| 57 | 3300002450 | JGI24695J34938_10234892 | JGI24695J34938_102348922 | 121 |
| 58 | 3300002450 | JGI24695J34938_10237105 | JGI24695J34938_102371051 | 121 |
| 59 | 3300002450 | JGI24695J34938_10404988 | JGI24695J34938_104049882 | 121 |
| 60 | 3300002450 | JGI24695J34938_10429571 | JGI24695J34938_104295711 | 121 |
| 61 | 3300042590 | Ga0466690_400861 | Ga0466690_400861_1144_1509 | 121 |
| 62 | 3300042596 | Ga0466696_418204 | Ga0466696_418204_1482_1847 | 121 |
| 63 | 3300042605 | Ga0466716_347766 | Ga0466716_347766_2489_2854 | 121 |
| 64 | 3300042606 | Ga0466719_029723 | Ga0466719_029723_6671_7036 | 121 |
| 65 | 3300042616 | Ga0466715_317829 | Ga0466715_317829_21341_21706 | 121 |
| 66 | 3300042617 | Ga0466718_031990 | Ga0466718_031990_2111_2476 | 121 |
| 67 | 3300042617 | Ga0466718_063326 | Ga0466718_063326_666_1031 | 121 |
| 68 | 3300042617 | Ga0466718_122256 | Ga0466718_122256_20243_20608 | 121 |
| 69 | 3300042620 | Ga0466728_007874 | Ga0466728_007874_1337_1702 | 121 |
| 70 | 3300042652 | Ga0466708_060683 | Ga0466708_060683_32274_32639 | 121 |
| 71 | iso_pr_bacteria | 2781125631 | 2781268147 | 121 |
| 72 | 3300000089 | AustNasuHG_c1003874 | AustNasuHG_10038744 | 122 |
| 73 | 3300000089 | AustNasuHG_c1011147 | AustNasuHG_10111475 | 122 |
| 74 | 3300000089 | AustNasuHG_c1016028 | AustNasuHG_10160284 | 122 |
| 75 | 3300005200 | Ga0072940_1058989 | Ga0072940_10589892 | 122 |
| 76 | 3300005485 | Ga0074263_109306 | Ga0074263_1093064 | 122 |
| 77 | 3300024493 | Ga0264413_102040 | Ga0264413_1020407 | 122 |
| 78 | 3300042615 | Ga0466711_394852 | Ga0466711_394852_2107_2475 | 122 |
| 79 | 3300042620 | Ga0466728_005858 | Ga0466728_005858_2420_2788 | 122 |
| 80 | 3300000089 | AustNasuHG_c1000213 | AustNasuHG_100021315 | 123 |
| 81 | 3300000089 | AustNasuHG_c1002306 | AustNasuHG_10023069 | 123 |
| 82 | 3300000089 | AustNasuHG_c1005189 | AustNasuHG_10051897 | 123 |
| 83 | 3300000089 | AustNasuHG_c1009687 | AustNasuHG_10096873 | 123 |
| 84 | 3300005071 | Ga0068302_10111791 | Ga0068302_101117915 | 123 |
| 85 | 3300024493 | Ga0264413_103070 | Ga0264413_10307013 | 123 |
| 86 | 3300024493 | Ga0264413_107804 | Ga0264413_1078046 | 123 |
| 87 | 3300042591 | Ga0466692_034249 | Ga0466692_034249_934_1305 | 123 |
| 88 | 3300042592 | Ga0466693_074463 | Ga0466693_074463_5462_5833 | 123 |
| 89 | 3300042617 | Ga0466718_016063 | Ga0466718_016063_19153_19524 | 123 |
| 90 | 3300042617 | Ga0466718_080120 | Ga0466718_080120_358_729 | 123 |
| 91 | 3300042617 | Ga0466718_118023 | Ga0466718_118023_6631_7002 | 123 |
| 92 | 3300042617 | Ga0466718_119015 | Ga0466718_119015_73_444 | 123 |
| 93 | 3300042621 | Ga0466729_185568 | Ga0466729_185568_41_412 | 123 |
| 94 | 3300002450 | JGI24695J34938_10002227 | JGI24695J34938_100022275 | 124 |
| 95 | 3300005201 | Ga0072941_1758604 | Ga0072941_17586042 | 124 |
| 96 | 3300042590 | Ga0466690_060592 | Ga0466690_060592_10115_10489 | 124 |
| 97 | 3300042593 | Ga0466691_167043 | Ga0466691_167043_3645_4019 | 124 |
| 98 | 3300042605 | Ga0466716_257662 | Ga0466716_257662_16693_17067 | 124 |
| 99 | 3300042616 | Ga0466715_386829 | Ga0466715_386829_6486_6860 | 124 |
| 100 | 3300042604 | Ga0466717_173403 | Ga0466717_173403_1330_1707 | 125 |
| 101 | 3300042607 | Ga0466720_142258 | Ga0466720_142258_9360_9737 | 125 |
| 102 | 3300042602 | Ga0466713_007535 | Ga0466713_007535_390_770 | 126 |
| 103 | 3300042616 | Ga0466715_503781 | Ga0466715_503781_18522_18902 | 126 |
| 104 | 3300002449 | JGI24698J34947_10000471 | JGI24698J34947_100004713 | 127 |
| 105 | 3300002450 | JGI24695J34938_10000611 | JGI24695J34938_1000061121 | 127 |
| 106 | 3300002450 | JGI24695J34938_10027576 | JGI24695J34938_100275762 | 127 |
| 107 | 3300042601 | Ga0466707_276910 | Ga0466707_276910_384_767 | 127 |
| 108 | 3300042590 | Ga0466690_313164 | Ga0466690_313164_1640_2026 | 128 |
| 109 | 3300042617 | Ga0466718_045180 | Ga0466718_045180_713_1099 | 128 |
| 110 | 3300042624 | Ga0466735_125576 | Ga0466735_125576_2371_2757 | 128 |
| 111 | 3300042636 | Ga0466703_135729 | Ga0466703_135729_8214_8600 | 128 |
| 112 | 3300042607 | Ga0466720_172607 | Ga0466720_172607_502_897 | 131 |
| 113 | 3300042652 | Ga0466708_130167 | Ga0466708_130167_46968_47363 | 131 |
| 114 | 3300042617 | Ga0466718_018949 | Ga0466718_018949_4465_4866 | 133 |
| 115 | 3300042617 | Ga0466718_122319 | Ga0466718_122319_3244_3645 | 133 |
| 116 | 3300042619 | Ga0466726_048716 | Ga0466726_048716_216_665 | 149 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.