Protein Family IF07914

Metagenome Isolate
119 Members
46 Samples
112 Scaffolds
273.61 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_069120|Ga0466718_069120_285_1238
Length
317 aa
Sequence
LNGIFQDLSGTGTFEQSGFGDNKMKILYVAELVGKAGIYVLKKALPELKRQEQIDFTVICADGATGGNGLGRNHAGYIRKLGADAITTGDYCFYKKDLVENWVPTVVRPVNLGRMGNGQKQGHLSLEQVPGFGWRVFKVGGTGSPNQPRSVVKVAVAVFLGANFTRIRADNPFRELKPFLEKLQAETPYVVVDFHAWATGEKRIFFTVAAGLCTAVIGSHSRVQTADEAILDGTAVICDAGRTGSTESVGGTDSAVRIQEYLTEIPDWTKDAWEKCELQGVIVEADGQGRALCIKRLRIPVPAGNQKMPEPDISEEG

📊 Sample Types

Isolate 5.9%
Metagenome 94.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.2%
Kalotermitidae 28.9%
Unclassified 15.6%
Termopsidae 6.7%
Rhinotermitidae 6.7%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
4 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
13 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
14 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
26 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
29 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
30 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_185573 3300042659 Bacteria 3847
2 Ga0466715_054604 3300042616 Bacteria 4131
3 Ga0466723_043102 3300042618 Bacteria 3110
4 Ga0466726_400468 3300042619 Bacteria 1737
5 Ga0466735_004050 3300042624 Bacteria 3103
6 Ga0466704_066849 3300042643 Bacteria 22409
7 Ga0466708_130050 3300042652 Bacteria 3400
8 JGI24698J34947_10009037 3300002449 Bacteria 5467
9 JGI24698J34947_10129856 3300002449 Bacteria 1079
10 JGI24695J34938_10012823 3300002450 Unclassified 4427
11 Ga0415639_008208 3300038395 Bacteria 4391
12 Ga0456237_0014503 3300041968 Bacteria 1123
13 Ga0466692_017288 3300042591 Bacteria 31305
14 Ga0466696_222543 3300042596 Bacteria 9272
15 Ga0466700_014474 3300042600 Bacteria 1551
16 Ga0466716_023000 3300042605 Bacteria 13846
17 Ga0466716_140376 3300042605 Bacteria 16825
18 Ga0123356_10000810 3300010049 Bacteria 34730
19 Ga0466711_038610 3300042615 Bacteria 6823
20 Ga0466718_019811 3300042617 Bacteria 2390
21 Ga0466723_009928 3300042618 Bacteria 4532
22 Ga0466723_200332 3300042618 Bacteria 6990
23 Ga0466723_233927 3300042618 Bacteria 1292
24 Ga0466702_160223 3300042635 Bacteria 16616
25 Ga0466703_030185 3300042636 Bacteria 2434
26 Ga0466709_098425 3300042648 Bacteria 30883
27 Ga0466708_091345 3300042652 Bacteria 69103
28 Ga0466708_110918 3300042652 Bacteria 4880
29 JGI24695J34938_10000013 3300002450 Bacteria 122387
30 JGI24695J34938_10000297 3300002450 Bacteria 49030
31 Ga0466692_080331 3300042591 Unclassified 4324
32 Ga0466695_107527 3300042595 Bacteria 7154
33 Ga0466719_167173 3300042606 Bacteria 32740
34 Ga0466722_256921 3300042609 Bacteria 9980
35 Ga0466718_069120 3300042617 Bacteria 1258
36 Ga0466728_228471 3300042620 Bacteria 4080
37 Ga0466702_174842 3300042635 Bacteria 3830
38 Ga0466703_082590 3300042636 Bacteria 51436
39 JGI24695J34938_10006087 3300002450 Bacteria 7345
40 Ga0072941_1028093 3300005201 Bacteria 7087
41 Ga0415639_130128 3300038395 Bacteria 6989
42 Ga0466692_107500 3300042591 Bacteria 1063
43 Ga0466691_059914 3300042593 Bacteria 14735
44 Ga0466694_091564 3300042594 Bacteria 1220
45 Ga0466715_126101 3300042616 Bacteria 21047
46 Ga0466718_114674 3300042617 Bacteria 2005
47 Ga0466718_129353 3300042617 Bacteria 3606
48 Ga0466723_156747 3300042618 Bacteria 14772
49 Ga0466703_218316 3300042636 Bacteria 2764
50 Ga0466704_167806 3300042643 Bacteria 13695
51 Ga0466708_140451 3300042652 Bacteria 25951
52 Ga0466727_120668 3300042655 Bacteria 1318
53 Ga0466727_330439 3300042655 Bacteria 1280
54 JGI24698J34947_10008558 3300002449 Bacteria 5617
55 JGI24695J34938_10000324 3300002450 Bacteria 46911
56 JGI24700J35501_10930493 3300002508 Bacteria 14694
57 Ga0072940_1287264 3300005200 Bacteria 1511
58 Ga0466716_474550 3300042605 Unclassified 4302
59 Ga0466719_254533 3300042606 Bacteria 6301
60 Ga0466732_246099 3300042656 Bacteria 1221
61 Ga0466712_169515 3300042614 Bacteria 5416
62 Ga0466712_230749 3300042614 Bacteria 2987
63 Ga0466711_099713 3300042615 Bacteria 7714
64 Ga0466715_622696 3300042616 Bacteria 8312
65 Ga0466723_333488 3300042618 Bacteria 2890
66 Ga0466731_296600 3300042622 Bacteria 2255
67 Ga0466735_010857 3300042624 Bacteria 3672
68 Ga0466704_314082 3300042643 Bacteria 2229
69 Nasutiter_Contig02598 2030936001 Bacteria 1525
70 Ga0072941_1009383 3300005201 Bacteria 11845
71 Ga0466722_088142 3300042609 Bacteria 11867
72 Ga0466718_007774 3300042617 Bacteria 5468
73 Ga0466718_009679 3300042617 Bacteria 7936
74 Ga0466718_047454 3300042617 Bacteria 1579
75 Ga0466702_073469 3300042635 Bacteria 14454
76 Ga0466708_187178 3300042652 Bacteria 4109
77 Ga0466708_431996 3300042652 Bacteria 3947
78 Ga0466727_156801 3300042655 Bacteria 1939
79 Ga0466727_348257 3300042655 Bacteria 1224
80 Ga0466693_081613 3300042592 Bacteria 56251
81 Ga0466694_166663 3300042594 Bacteria 1201
82 Ga0466717_075146 3300042604 Bacteria 3140
83 Ga0466716_051368 3300042605 Bacteria 4644
84 Ga0466705_034691 3300042612 Bacteria 7148
85 Ga0466715_073448 3300042616 Bacteria 4158
86 Ga0466718_170094 3300042617 Bacteria 15036
87 Ga0466703_301732 3300042636 Bacteria 14083
88 Ga0466704_094042 3300042643 Bacteria 2257
89 Ga0466704_223682 3300042643 Bacteria 2884
90 Ga0466704_324805 3300042643 Bacteria 1796
91 Ga0466708_095269 3300042652 Bacteria 23314
92 JGI24695J34938_10000391 3300002450 Bacteria 43169
93 JGI24695J34938_10004419 3300002450 Unclassified 9236
94 JGI24695J34938_10010133 3300002450 Bacteria 5191
95 Ga0072941_1002026 3300005201 Bacteria 4966
96 Ga0466691_012013 3300042593 Bacteria 12727
97 Ga0466691_220592 3300042593 Bacteria 13327
98 Ga0466719_138573 3300042606 Bacteria 2036
99 Ga0466722_061629 3300042609 Bacteria 5432
100 Ga0466732_314752 3300042656 Bacteria 1173
101 Ga0123353_11060947 3300010167 Unclassified 1081
102 Ga0466712_084915 3300042614 Bacteria 2614
103 Ga0466735_036586 3300042624 Bacteria 2270
104 Ga0466702_040701 3300042635 Bacteria 3604
105 Ga0466704_007429 3300042643 Bacteria 5020
106 Ga0466709_050086 3300042648 Bacteria 5430
107 JGI24695J34938_10005854 3300002450 Bacteria 7561
108 JGI24695J34938_10017130 3300002450 Bacteria 3662
109 Ga0072941_1028092 3300005201 Bacteria 5793
110 Ga0466694_138105 3300042594 Bacteria 4715
111 Ga0466694_235778 3300042594 Bacteria 1353
112 Ga0466722_087624 3300042609 Bacteria 1488

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_120668 Ga0466727_120668_20_739 239
2 3300042643 Ga0466704_324805 Ga0466704_324805_690_1445 251
3 3300005200 Ga0072940_1287264 Ga0072940_12872642 255
4 3300042636 Ga0466703_301732 Ga0466703_301732_10619_11416 256
5 3300042612 Ga0466705_034691 Ga0466705_034691_5806_6579 257
6 3300042606 Ga0466719_254533 Ga0466719_254533_237_1013 258
7 3300042616 Ga0466715_054604 Ga0466715_054604_227_1003 258
8 3300038395 Ga0415639_130128 Ga0415639_130128_3706_4488 260
9 3300042592 Ga0466693_081613 Ga0466693_081613_12742_13524 260
10 3300042593 Ga0466691_012013 Ga0466691_012013_8995_9777 260
11 3300042605 Ga0466716_051368 Ga0466716_051368_2178_2960 260
12 3300042609 Ga0466722_088142 Ga0466722_088142_9024_9893 260
13 3300042618 Ga0466723_043102 Ga0466723_043102_2159_2941 260
14 3300042618 Ga0466723_200332 Ga0466723_200332_4471_5253 260
15 3300002450 JGI24695J34938_10017130 JGI24695J34938_100171304 261
16 3300010167 Ga0123353_11060947 Ga0123353_110609472 261
17 3300042596 Ga0466696_222543 Ga0466696_222543_4401_5186 261
18 3300042652 Ga0466708_130050 Ga0466708_130050_1333_2124 263
19 3300002450 JGI24695J34938_10000391 JGI24695J34938_1000039121 264
20 3300002450 JGI24695J34938_10010133 JGI24695J34938_100101333 264
21 3300002450 JGI24695J34938_10012823 JGI24695J34938_100128235 264
22 3300042618 Ga0466723_156747 Ga0466723_156747_2515_3309 264
23 3300042635 Ga0466702_174842 Ga0466702_174842_339_1133 264
24 3300042648 Ga0466709_098425 Ga0466709_098425_25204_25998 264
25 3300002450 JGI24695J34938_10000324 JGI24695J34938_100003247 265
26 3300042656 Ga0466732_246099 Ga0466732_246099_36_851 265
27 3300002450 JGI24695J34938_10006087 JGI24695J34938_100060874 266
28 3300042594 Ga0466694_138105 Ga0466694_138105_74_874 266
29 3300042615 Ga0466711_038610 Ga0466711_038610_5319_6119 266
30 3300042624 Ga0466735_010857 Ga0466735_010857_2418_3218 266
31 3300042636 Ga0466703_030185 Ga0466703_030185_704_1504 266
32 3300042643 Ga0466704_094042 Ga0466704_094042_479_1336 266
33 3300042643 Ga0466704_223682 Ga0466704_223682_1046_1903 266
34 3300002450 JGI24695J34938_10000013 JGI24695J34938_1000001351 267
35 3300042591 Ga0466692_017288 Ga0466692_017288_14729_15532 267
36 3300042609 Ga0466722_087624 Ga0466722_087624_409_1212 267
37 3300042617 Ga0466718_114674 Ga0466718_114674_935_1738 267
38 3300042643 Ga0466704_314082 Ga0466704_314082_175_978 267
39 3300042652 Ga0466708_140451 Ga0466708_140451_24294_25097 267
40 iso_pr_bacteria 2781125661 2781333150 267
41 3300010049 Ga0123356_10000810 Ga0123356_1000081025 268
42 3300042594 Ga0466694_091564 Ga0466694_091564_22_828 268
43 3300042606 Ga0466719_167173 Ga0466719_167173_4643_5449 268
44 3300042624 Ga0466735_036586 Ga0466735_036586_284_1090 268
45 3300042635 Ga0466702_073469 Ga0466702_073469_8948_9754 268
46 3300042643 Ga0466704_007429 Ga0466704_007429_3539_4345 268
47 iso_pr_bacteria 2819994798 2819996795 268
48 3300002450 JGI24695J34938_10000297 JGI24695J34938_100002979 269
49 3300002508 JGI24700J35501_10930493 JGI24700J35501_1093049314 269
50 3300005201 Ga0072941_1002026 Ga0072941_10020266 269
51 3300038395 Ga0415639_008208 Ga0415639_008208_1514_2323 269
52 3300042606 Ga0466719_138573 Ga0466719_138573_224_1033 269
53 3300042609 Ga0466722_061629 Ga0466722_061629_842_1651 269
54 3300042617 Ga0466718_007774 Ga0466718_007774_1023_1832 269
55 3300042643 Ga0466704_167806 Ga0466704_167806_12027_12836 269
56 iso_pr_bacteria 2772190978 2773729786 269
57 3300042594 Ga0466694_235778 Ga0466694_235778_163_975 270
58 3300042609 Ga0466722_256921 Ga0466722_256921_1804_2616 270
59 3300042614 Ga0466712_084915 Ga0466712_084915_654_1466 270
60 3300042614 Ga0466712_169515 Ga0466712_169515_1637_2449 270
61 3300042617 Ga0466718_009679 Ga0466718_009679_5509_6321 270
62 3300042635 Ga0466702_040701 Ga0466702_040701_420_1232 270
63 2030936001 Nasutiter_Contig02598 Nasutiterm_1446110 271
64 3300002449 JGI24698J34947_10008558 JGI24698J34947_100085583 271
65 3300002449 JGI24698J34947_10009037 JGI24698J34947_100090374 271
66 3300002449 JGI24698J34947_10129856 JGI24698J34947_101298561 271
67 3300002450 JGI24695J34938_10005854 JGI24695J34938_100058545 271
68 3300042617 Ga0466718_019811 Ga0466718_019811_773_1588 271
69 iso_pr_bacteria 2781125643 2781293528 271
70 3300002450 JGI24695J34938_10004419 JGI24695J34938_100044195 272
71 3300042635 Ga0466702_160223 Ga0466702_160223_4591_5409 272
72 3300042616 Ga0466715_126101 Ga0466715_126101_14987_15811 274
73 3300042617 Ga0466718_047454 Ga0466718_047454_227_1051 274
74 3300042652 Ga0466708_187178 Ga0466708_187178_1280_2104 274
75 3300042593 Ga0466691_059914 Ga0466691_059914_1728_2555 275
76 3300042604 Ga0466717_075146 Ga0466717_075146_1661_2488 275
77 3300042618 Ga0466723_233927 Ga0466723_233927_107_988 275
78 3300042656 Ga0466732_314752 Ga0466732_314752_47_874 275
79 3300042595 Ga0466695_107527 Ga0466695_107527_3542_4372 276
80 3300042622 Ga0466731_296600 Ga0466731_296600_359_1204 276
81 3300042636 Ga0466703_218316 Ga0466703_218316_534_1364 276
82 3300041968 Ga0456237_0014503 Ga0456237_0014503_263_1096 277
83 3300042624 Ga0466735_004050 Ga0466735_004050_2000_2833 277
84 3300042655 Ga0466727_330439 Ga0466727_330439_427_1260 277
85 3300042648 Ga0466709_050086 Ga0466709_050086_2784_3620 278
86 3300042591 Ga0466692_080331 Ga0466692_080331_3061_3900 279
87 3300042614 Ga0466712_230749 Ga0466712_230749_494_1333 279
88 3300042605 Ga0466716_474550 Ga0466716_474550_2446_3288 280
89 3300042655 Ga0466727_156801 Ga0466727_156801_1004_1846 280
90 3300042600 Ga0466700_014474 Ga0466700_014474_522_1367 281
91 3300042618 Ga0466723_333488 Ga0466723_333488_1023_1913 281
92 iso_pr_bacteria 2781125691 2781429539 283
93 3300005201 Ga0072941_1028092 Ga0072941_10280925 284
94 3300042605 Ga0466716_023000 Ga0466716_023000_4422_5276 284
95 3300042652 Ga0466708_431996 Ga0466708_431996_2914_3768 284
96 3300042593 Ga0466691_220592 Ga0466691_220592_4770_5627 285
97 3300042605 Ga0466716_140376 Ga0466716_140376_280_1137 285
98 3300042616 Ga0466715_622696 Ga0466715_622696_2500_3537 285
99 3300042620 Ga0466728_228471 Ga0466728_228471_997_1854 285
100 3300042636 Ga0466703_082590 Ga0466703_082590_39631_40488 285
101 3300042652 Ga0466708_095269 Ga0466708_095269_5526_6383 285
102 iso_pr_bacteria 2781125630 2781267197 286
103 3300042591 Ga0466692_107500 Ga0466692_107500_144_1007 287
104 3300042616 Ga0466715_073448 Ga0466715_073448_2416_3381 289
105 3300042615 Ga0466711_099713 Ga0466711_099713_4274_5146 290
106 3300042652 Ga0466708_091345 Ga0466708_091345_10965_11837 290
107 3300042652 Ga0466708_110918 Ga0466708_110918_3848_4720 290
108 iso_pr_bacteria 2781125629 2781264687 291
109 3300042594 Ga0466694_166663 Ga0466694_166663_220_1098 292
110 3300042617 Ga0466718_129353 Ga0466718_129353_1571_2449 292
111 3300042655 Ga0466727_348257 Ga0466727_348257_128_1015 295
112 3300042617 Ga0466718_170094 Ga0466718_170094_12993_13916 297
113 3300042619 Ga0466726_400468 Ga0466726_400468_664_1557 297
114 3300005201 Ga0072941_1009383 Ga0072941_10093839 298
115 3300042643 Ga0466704_066849 Ga0466704_066849_3274_4170 298
116 3300042659 Ga0466733_185573 Ga0466733_185573_2929_3828 299
117 3300042618 Ga0466723_009928 Ga0466723_009928_1074_2000 308
118 3300005201 Ga0072941_1028093 Ga0072941_10280933 317
119 3300042617 Ga0466718_069120 Ga0466718_069120_285_1238 317

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13277 YmdB YmdB-like protein 27 296 0.93

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4b2o-assembly1.cif.gz_D Crystal structure of Bacillus subtilis YmdB, a global regulator of late adaptive responses. 0.912 24 300
1t70-assembly3.cif.gz_E Crystal structure of a novel phosphatase from Deinococcus radiodurans 0.88 24 300
1t71-assembly1.cif.gz_A Crystal structure of a novel phosphatase Mycoplasma pneumoniaefrom 0.861 21 300
2cv9-assembly1.cif.gz_A Crystal structure of a hypothetical protein from Thermus thermophilus HB8 0.854 24 302
6gf6-assembly1.cif.gz_B Molecular basis of egg coat filament cross-linking: high-resolution structure of the partially deglycosylated ZP1 ZP-N1 domain homodimer 0.806 275 305
IDDescriptionScoreStartEndSuperfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9125 24 300 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8631 24 302 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8614 21 300 3.60.21.10
af_O45003_1_124_2.60.40.2240 Mainly Beta;Sandwich;Immunoglobulin-like;Acyl-CoA thioester hydrolase/BAAT N-terminal domain 0.8242 277 298 2.60.40.2240
af_Q925F2_39_156_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7495 275 300 2.60.40.10
IDDescriptionScoreStartEndGO Terms
AF-A0A7Y2JDI4-F1-model_v4 Uncharacterized/unreviewed 0.9891 26 84
AF-A0A3B0PD68-F1-model_v4 Uncharacterized/unreviewed 0.988 24 93 GO:0004113
AF-X1N2U3-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9844 24 98 GO:0004113

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.