Protein Family IF07912
Metagenome
Isolate
186
Members
73
Samples
161
Scaffolds
85.61
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_064874|Ga0466718_064874_538_843
- Length
- 101 aa
- Sequence
- MKTRTKPEIRLWEQELEMAHKKGLGSSRNGRDSQAKRLGVKRFAGEKVTIGNIIVRQRGTHIHPGENVGRGSDDTLFALKDGILEFTRGARRKVHVRPFEE
Sample Types
Isolate
13.4%
Metagenome
86.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
38.0%
Termitidae
32.4%
Kalotermitidae
16.9%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Drosophilidae
1.4%
Hodotermitidae
1.4%
Passalidae
1.4%
Taxonomy
Archaea
0
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 2 | 2820836992 | Unclassified Actinobacteria Lab288P4bin32 | Isolate | Unclassified |
| 3 | 2820870086 | Unclassified Actinobacteria Lab288P3bin107 | Isolate | Unclassified |
| 4 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 5 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 17 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 18 | 2820893114 | Unclassified Actinobacteria Lab288P1bin125 | Isolate | Unclassified |
| 19 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 35 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 36 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 37 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 49 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 50 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 51 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 2820940989 | Unclassified Actinobacteria Emb289P1bin20 | Isolate | Unclassified |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 60 | 2820848511 | Unclassified Actinobacteria Lab288P3bin86 | Isolate | Unclassified |
| 61 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 62 | 2820941830 | Unclassified Actinobacteria Cu122P5bin49 | Isolate | Unclassified |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 66 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 67 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 68 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 69 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 70 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 71 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 72 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 73 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_044798 | 3300042601 | Bacteria | 5007 |
| 2 | Ga0466713_068002 | 3300042602 | Bacteria | 5114 |
| 3 | Ga0123355_10000884 | 3300009826 | Bacteria | 41468 |
| 4 | Ga0123355_12066379 | 3300009826 | Bacteria | 526 |
| 5 | Ga0123356_10990798 | 3300010049 | Bacteria | 1011 |
| 6 | Ga0123356_11682692 | 3300010049 | Bacteria | 787 |
| 7 | Ga0123356_12332408 | 3300010049 | Bacteria | 669 |
| 8 | Ga0123353_10000156 | 3300010167 | Bacteria | 86182 |
| 9 | Ga0123353_10042430 | 3300010167 | Bacteria | 7194 |
| 10 | Ga0123353_10181557 | 3300010167 | Bacteria | 3330 |
| 11 | Ga0123353_10193071 | 3300010167 | Bacteria | 3212 |
| 12 | Ga0123354_10000051 | 3300010882 | Bacteria | 89133 |
| 13 | Ga0466692_109692 | 3300042591 | Bacteria | 1342 |
| 14 | Ga0466693_267014 | 3300042592 | Bacteria | 3895 |
| 15 | Ga0466696_136583 | 3300042596 | Bacteria | 2106 |
| 16 | Ga0466696_269782 | 3300042596 | Unclassified | 2053 |
| 17 | Ga0068302_10069728 | 3300005071 | Unclassified | 8035 |
| 18 | Ga0466715_011915 | 3300042616 | Bacteria | 7269 |
| 19 | Ga0466726_141172 | 3300042619 | Unclassified | 15034 |
| 20 | Ga0466731_195106 | 3300042622 | Unclassified | 1142 |
| 21 | Ga0466703_120282 | 3300042636 | Bacteria | 7170 |
| 22 | Ga0466727_330731 | 3300042655 | Bacteria | 4846 |
| 23 | Ga0466700_234709 | 3300042600 | Bacteria | 14226 |
| 24 | Ga0466700_434328 | 3300042600 | Unclassified | 2722 |
| 25 | Ga0466722_268238 | 3300042609 | Unclassified | 1771 |
| 26 | Ga0466698_266744 | 3300042610 | Bacteria | 1697 |
| 27 | Ga0123355_10001283 | 3300009826 | Bacteria | 35057 |
| 28 | Ga0123355_10017803 | 3300009826 | Bacteria | 11240 |
| 29 | Ga0123355_10084225 | 3300009826 | Bacteria | 5064 |
| 30 | Ga0123356_10002929 | 3300010049 | Bacteria | 18064 |
| 31 | Ga0123353_10979269 | 3300010167 | Bacteria | 1140 |
| 32 | Ga0123354_10366405 | 3300010882 | Bacteria | 1263 |
| 33 | Ga0466690_264738 | 3300042590 | Bacteria | 2588 |
| 34 | JGI24696J40584_12942492 | 3300002834 | Bacteria | 1743 |
| 35 | Ga0466705_132287 | 3300042612 | Bacteria | 3695 |
| 36 | Ga0466703_200852 | 3300042636 | Bacteria | 4977 |
| 37 | Ga0466704_179495 | 3300042643 | Bacteria | 5800 |
| 38 | Ga0466704_578001 | 3300042643 | Unclassified | 3488 |
| 39 | Ga0466706_035461 | 3300042599 | Bacteria | 1410 |
| 40 | Ga0466717_296990 | 3300042604 | Bacteria | 20745 |
| 41 | Ga0123356_10098262 | 3300010049 | Bacteria | 2803 |
| 42 | Ga0123353_10383923 | 3300010167 | Bacteria | 2099 |
| 43 | Ga0123353_11840728 | 3300010167 | Bacteria | 750 |
| 44 | Ga0123354_10543217 | 3300010882 | Unclassified | 881 |
| 45 | Ga0466692_057511 | 3300042591 | Bacteria | 12767 |
| 46 | Ga0466693_086985 | 3300042592 | Bacteria | 1526 |
| 47 | Ga0466693_252486 | 3300042592 | Unclassified | 2200 |
| 48 | Ga0466696_360566 | 3300042596 | Unclassified | 3306 |
| 49 | JGI24702J35022_10001985 | 3300002462 | Bacteria | 12619 |
| 50 | JGI24702J35022_10058886 | 3300002462 | Bacteria | 2052 |
| 51 | JGI24699J35502_10368742 | 3300002509 | Bacteria | 548 |
| 52 | Ga0466705_426130 | 3300042612 | Unclassified | 7520 |
| 53 | Ga0466715_124107 | 3300042616 | Unclassified | 1606 |
| 54 | Ga0466726_090880 | 3300042619 | Bacteria | 48618 |
| 55 | Ga0466734_150609 | 3300042623 | Bacteria | 1785 |
| 56 | Ga0466727_163088 | 3300042655 | Bacteria | 1354 |
| 57 | Ga0466701_043882 | 3300042598 | Bacteria | 1300 |
| 58 | Ga0466706_139903 | 3300042599 | Bacteria | 1109 |
| 59 | Ga0466719_124061 | 3300042606 | Bacteria | 6375 |
| 60 | Ga0466722_168944 | 3300042609 | Bacteria | 1608 |
| 61 | Ga0123353_10196377 | 3300010167 | Bacteria | 3180 |
| 62 | Ga0123353_10819088 | 3300010167 | Unclassified | 1282 |
| 63 | Ga0123354_10031845 | 3300010882 | Bacteria | 8271 |
| 64 | Ga0264413_101447 | 3300024493 | Bacteria | 163936 |
| 65 | Ga0466694_215823 | 3300042594 | Bacteria | 1852 |
| 66 | Ga0466696_432425 | 3300042596 | Unclassified | 2374 |
| 67 | JGI24695J34938_10537646 | 3300002450 | Bacteria | 538 |
| 68 | JGI24705J35276_12028954 | 3300002504 | Bacteria | 885 |
| 69 | Ga0074304_1160000 | 3300005319 | Bacteria | 786 |
| 70 | Ga0466710_134133 | 3300042613 | Bacteria | 13430 |
| 71 | Ga0466710_210500 | 3300042613 | Bacteria | 1015 |
| 72 | Ga0466723_338395 | 3300042618 | Bacteria | 3653 |
| 73 | Ga0466728_075161 | 3300042620 | Bacteria | 50622 |
| 74 | Ga0466731_337668 | 3300042622 | Bacteria | 1425 |
| 75 | Ga0466734_126863 | 3300042623 | Bacteria | 1022 |
| 76 | Ga0466703_093645 | 3300042636 | Bacteria | 11874 |
| 77 | Ga0466704_055205 | 3300042643 | Unclassified | 2274 |
| 78 | Ga0466709_148383 | 3300042648 | Bacteria | 15579 |
| 79 | Ga0466708_335294 | 3300042652 | Unclassified | 1661 |
| 80 | Ga0466700_041664 | 3300042600 | Bacteria | 1297 |
| 81 | Ga0466707_053313 | 3300042601 | Bacteria | 1166 |
| 82 | Ga0123357_10014245 | 3300009784 | Bacteria | 10368 |
| 83 | Ga0123356_10000019 | 3300010049 | Bacteria | 179881 |
| 84 | Ga0466692_006474 | 3300042591 | Bacteria | 27806 |
| 85 | Ga0466692_169654 | 3300042591 | Bacteria | 21508 |
| 86 | Ga0466696_068205 | 3300042596 | Bacteria | 3053 |
| 87 | JGI24702J35022_10006763 | 3300002462 | Bacteria | 6607 |
| 88 | JGI24705J35276_12210943 | 3300002504 | Unclassified | 1840 |
| 89 | Ga0072941_1298217 | 3300005201 | Bacteria | 822 |
| 90 | Ga0466711_059144 | 3300042615 | Bacteria | 3231 |
| 91 | Ga0466711_065069 | 3300042615 | Bacteria | 21302 |
| 92 | Ga0466711_481016 | 3300042615 | Bacteria | 4722 |
| 93 | Ga0466718_064874 | 3300042617 | Bacteria | 1378 |
| 94 | Ga0466726_176554 | 3300042619 | Bacteria | 8445 |
| 95 | Ga0466729_068067 | 3300042621 | Bacteria | 4071 |
| 96 | Ga0466729_086701 | 3300042621 | Bacteria | 1769 |
| 97 | Ga0466729_116285 | 3300042621 | Bacteria | 2106 |
| 98 | Ga0466729_124990 | 3300042621 | Bacteria | 2249 |
| 99 | Ga0466704_105898 | 3300042643 | Unclassified | 1307 |
| 100 | Ga0466707_366974 | 3300042601 | Unclassified | 4043 |
| 101 | Ga0123355_10009738 | 3300009826 | Bacteria | 14649 |
| 102 | Ga0123355_10984814 | 3300009826 | Bacteria | 898 |
| 103 | Ga0123353_10371221 | 3300010167 | Bacteria | 2145 |
| 104 | Ga0123353_10432693 | 3300010167 | Bacteria | 1945 |
| 105 | Ga0123353_11147928 | 3300010167 | Bacteria | 1026 |
| 106 | Ga0466690_049893 | 3300042590 | Unclassified | 5790 |
| 107 | Ga0466696_319122 | 3300042596 | Unclassified | 1512 |
| 108 | JGI24702J35022_10096611 | 3300002462 | Bacteria | 1613 |
| 109 | JGI24702J35022_10275303 | 3300002462 | Bacteria | 986 |
| 110 | Ga0068302_10069727 | 3300005071 | Unclassified | 4155 |
| 111 | Ga0072941_1696148 | 3300005201 | Bacteria | 1180 |
| 112 | Ga0466728_245440 | 3300042620 | Bacteria | 99636 |
| 113 | Ga0466729_077731 | 3300042621 | Bacteria | 1241 |
| 114 | Ga0466734_065075 | 3300042623 | Bacteria | 4219 |
| 115 | Ga0466708_062802 | 3300042652 | Bacteria | 45373 |
| 116 | Ga0466719_031017 | 3300042606 | Unclassified | 2151 |
| 117 | Ga0123357_10028873 | 3300009784 | Unclassified | 7516 |
| 118 | Ga0123357_10867568 | 3300009784 | Bacteria | 592 |
| 119 | Ga0123355_10012264 | 3300009826 | Bacteria | 13272 |
| 120 | Ga0123356_10067065 | 3300010049 | Bacteria | 3361 |
| 121 | Ga0123356_12901258 | 3300010049 | Bacteria | 599 |
| 122 | Ga0123353_10006900 | 3300010167 | Bacteria | 15255 |
| 123 | Ga0123353_10078600 | 3300010167 | Bacteria | 5302 |
| 124 | Ga0123353_10097722 | 3300010167 | Bacteria | 4733 |
| 125 | Ga0123353_10970459 | 3300010167 | Unclassified | 1146 |
| 126 | Ga0466690_326028 | 3300042590 | Bacteria | 13005 |
| 127 | Ga0466692_100562 | 3300042591 | Bacteria | 13923 |
| 128 | Ga0466696_396869 | 3300042596 | Bacteria | 7952 |
| 129 | JGI24702J35022_10912793 | 3300002462 | Unclassified | 547 |
| 130 | JGI24705J35276_12116865 | 3300002504 | Bacteria | 1060 |
| 131 | JGI24696J40584_12828452 | 3300002834 | Unclassified | 924 |
| 132 | JGI24696J40584_12926246 | 3300002834 | Bacteria | 1410 |
| 133 | Ga0466718_058599 | 3300042617 | Bacteria | 2143 |
| 134 | Ga0466728_271005 | 3300042620 | Unclassified | 3339 |
| 135 | Ga0466729_122502 | 3300042621 | Bacteria | 12405 |
| 136 | Ga0466697_061174 | 3300042611 | Bacteria | 1644 |
| 137 | Ga0466705_300094 | 3300042612 | Bacteria | 43128 |
| 138 | Ga0466703_239492 | 3300042636 | Bacteria | 16135 |
| 139 | Ga0466706_260201 | 3300042599 | Bacteria | 1195 |
| 140 | Ga0466707_390539 | 3300042601 | Bacteria | 3179 |
| 141 | Ga0466707_420740 | 3300042601 | Bacteria | 2372 |
| 142 | Ga0466713_033853 | 3300042602 | Bacteria | 35579 |
| 143 | Ga0466719_351059 | 3300042606 | Bacteria | 131310 |
| 144 | Ga0466722_141838 | 3300042609 | Bacteria | 1931 |
| 145 | Ga0466722_166861 | 3300042609 | Bacteria | 1115 |
| 146 | Ga0123357_10047274 | 3300009784 | Bacteria | 5833 |
| 147 | Ga0123357_10066729 | 3300009784 | Bacteria | 4797 |
| 148 | Ga0123355_10000146 | 3300009826 | Bacteria | 84653 |
| 149 | Ga0123355_12162601 | 3300009826 | Bacteria | 510 |
| 150 | Ga0123353_12007508 | 3300010167 | Bacteria | 708 |
| 151 | Ga0123353_12480063 | 3300010167 | Bacteria | 617 |
| 152 | Ga0415639_256394 | 3300038395 | Bacteria | 1417 |
| 153 | Ga0466694_293851 | 3300042594 | Bacteria | 1733 |
| 154 | Ga0466696_390725 | 3300042596 | Unclassified | 3186 |
| 155 | 2227108583 | 2225789004 | Bacteria | 37917 |
| 156 | Ga0466705_492739 | 3300042612 | Bacteria | 1313 |
| 157 | Ga0466718_017658 | 3300042617 | Bacteria | 86664 |
| 158 | Ga0466718_134653 | 3300042617 | Bacteria | 10692 |
| 159 | Ga0466723_099753 | 3300042618 | Bacteria | 4156 |
| 160 | Ga0466702_158330 | 3300042635 | Bacteria | 1558 |
| 161 | Ga0466708_300420 | 3300042652 | Bacteria | 6294 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042590 | Ga0466690_264738 | Ga0466690_264738_1199_1444 | 81 |
| 2 | 3300042591 | Ga0466692_006474 | Ga0466692_006474_25314_25559 | 81 |
| 3 | 3300042606 | Ga0466719_124061 | Ga0466719_124061_1839_2084 | 81 |
| 4 | 3300042618 | Ga0466723_099753 | Ga0466723_099753_3475_3720 | 81 |
| 5 | 3300042618 | Ga0466723_338395 | Ga0466723_338395_1296_1541 | 81 |
| 6 | 3300042599 | Ga0466706_139903 | Ga0466706_139903_278_526 | 82 |
| 7 | 3300042599 | Ga0466706_260201 | Ga0466706_260201_785_1033 | 82 |
| 8 | 3300042600 | Ga0466700_041664 | Ga0466700_041664_79_327 | 82 |
| 9 | 3300042600 | Ga0466700_434328 | Ga0466700_434328_814_1062 | 82 |
| 10 | 3300042601 | Ga0466707_053313 | Ga0466707_053313_120_368 | 82 |
| 11 | 3300042601 | Ga0466707_390539 | Ga0466707_390539_770_1018 | 82 |
| 12 | 3300042606 | Ga0466719_351059 | Ga0466719_351059_79114_79362 | 82 |
| 13 | 3300042612 | Ga0466705_492739 | Ga0466705_492739_533_781 | 82 |
| 14 | 3300042613 | Ga0466710_134133 | Ga0466710_134133_5438_5686 | 82 |
| 15 | 3300042619 | Ga0466726_141172 | Ga0466726_141172_9603_9851 | 82 |
| 16 | 3300042620 | Ga0466728_075161 | Ga0466728_075161_25690_25938 | 82 |
| 17 | 3300042620 | Ga0466728_245440 | Ga0466728_245440_81413_81661 | 82 |
| 18 | 3300042621 | Ga0466729_124990 | Ga0466729_124990_315_563 | 82 |
| 19 | 3300042623 | Ga0466734_126863 | Ga0466734_126863_357_605 | 82 |
| 20 | 3300042623 | Ga0466734_150609 | Ga0466734_150609_1069_1317 | 82 |
| 21 | 3300042643 | Ga0466704_179495 | Ga0466704_179495_3224_3472 | 82 |
| 22 | 3300042655 | Ga0466727_163088 | Ga0466727_163088_203_451 | 82 |
| 23 | iso_pr_bacteria | 2820852808 | 2820852894 | 82 |
| 24 | iso_pr_bacteria | 2820924633 | 2820924796 | 82 |
| 25 | 3300005071 | Ga0068302_10069728 | Ga0068302_100697287 | 83 |
| 26 | 3300005319 | Ga0074304_1160000 | Ga0074304_11600001 | 83 |
| 27 | 3300010049 | Ga0123356_10000019 | Ga0123356_10000019164 | 83 |
| 28 | 3300010049 | Ga0123356_10067065 | Ga0123356_100670652 | 83 |
| 29 | 3300010167 | Ga0123353_10000156 | Ga0123353_1000015678 | 83 |
| 30 | 3300010167 | Ga0123353_10181557 | Ga0123353_101815572 | 83 |
| 31 | 3300010167 | Ga0123353_10432693 | Ga0123353_104326932 | 83 |
| 32 | 3300010167 | Ga0123353_10979269 | Ga0123353_109792692 | 83 |
| 33 | 3300010167 | Ga0123353_12007508 | Ga0123353_120075082 | 83 |
| 34 | 3300024493 | Ga0264413_101447 | Ga0264413_101447155 | 83 |
| 35 | 3300042591 | Ga0466692_100562 | Ga0466692_100562_9634_9885 | 83 |
| 36 | 3300042592 | Ga0466693_086985 | Ga0466693_086985_248_499 | 83 |
| 37 | 3300042592 | Ga0466693_252486 | Ga0466693_252486_798_1049 | 83 |
| 38 | 3300042592 | Ga0466693_267014 | Ga0466693_267014_2404_2655 | 83 |
| 39 | 3300042596 | Ga0466696_136583 | Ga0466696_136583_850_1101 | 83 |
| 40 | 3300042621 | Ga0466729_068067 | Ga0466729_068067_21_272 | 83 |
| 41 | iso_pr_bacteria | 2820800812 | 2820802691 | 83 |
| 42 | iso_pr_bacteria | 2820906387 | 2820906830 | 83 |
| 43 | 3300002450 | JGI24695J34938_10537646 | JGI24695J34938_105376461 | 84 |
| 44 | 3300002462 | JGI24702J35022_10006763 | JGI24702J35022_100067635 | 84 |
| 45 | 3300002504 | JGI24705J35276_12028954 | JGI24705J35276_120289542 | 84 |
| 46 | 3300002509 | JGI24699J35502_10368742 | JGI24699J35502_103687421 | 84 |
| 47 | 3300002834 | JGI24696J40584_12942492 | JGI24696J40584_129424922 | 84 |
| 48 | 3300009784 | Ga0123357_10047274 | Ga0123357_100472742 | 84 |
| 49 | 3300010049 | Ga0123356_10098262 | Ga0123356_100982622 | 84 |
| 50 | 3300010167 | Ga0123353_10970459 | Ga0123353_109704592 | 84 |
| 51 | 3300042590 | Ga0466690_049893 | Ga0466690_049893_359_613 | 84 |
| 52 | 3300042590 | Ga0466690_326028 | Ga0466690_326028_5108_5362 | 84 |
| 53 | 3300042591 | Ga0466692_057511 | Ga0466692_057511_10877_11131 | 84 |
| 54 | 3300042591 | Ga0466692_109692 | Ga0466692_109692_220_474 | 84 |
| 55 | 3300042596 | Ga0466696_068205 | Ga0466696_068205_408_662 | 84 |
| 56 | 3300042596 | Ga0466696_269782 | Ga0466696_269782_1400_1654 | 84 |
| 57 | 3300042596 | Ga0466696_319122 | Ga0466696_319122_512_766 | 84 |
| 58 | 3300042596 | Ga0466696_360566 | Ga0466696_360566_1139_1393 | 84 |
| 59 | 3300042596 | Ga0466696_390725 | Ga0466696_390725_191_445 | 84 |
| 60 | 3300042596 | Ga0466696_396869 | Ga0466696_396869_5024_5278 | 84 |
| 61 | 3300042596 | Ga0466696_432425 | Ga0466696_432425_1910_2164 | 84 |
| 62 | 3300042601 | Ga0466707_044798 | Ga0466707_044798_1331_1585 | 84 |
| 63 | 3300042601 | Ga0466707_366974 | Ga0466707_366974_3301_3555 | 84 |
| 64 | 3300042601 | Ga0466707_420740 | Ga0466707_420740_1060_1314 | 84 |
| 65 | 3300042602 | Ga0466713_068002 | Ga0466713_068002_139_393 | 84 |
| 66 | 3300042604 | Ga0466717_296990 | Ga0466717_296990_7512_7766 | 84 |
| 67 | 3300042606 | Ga0466719_031017 | Ga0466719_031017_879_1133 | 84 |
| 68 | 3300042609 | Ga0466722_141838 | Ga0466722_141838_1374_1628 | 84 |
| 69 | 3300042609 | Ga0466722_166861 | Ga0466722_166861_849_1103 | 84 |
| 70 | 3300042609 | Ga0466722_168944 | Ga0466722_168944_85_339 | 84 |
| 71 | 3300042609 | Ga0466722_268238 | Ga0466722_268238_85_339 | 84 |
| 72 | 3300042610 | Ga0466698_266744 | Ga0466698_266744_344_598 | 84 |
| 73 | 3300042612 | Ga0466705_132287 | Ga0466705_132287_2710_2964 | 84 |
| 74 | 3300042612 | Ga0466705_300094 | Ga0466705_300094_15996_16250 | 84 |
| 75 | 3300042612 | Ga0466705_426130 | Ga0466705_426130_5715_5969 | 84 |
| 76 | 3300042613 | Ga0466710_210500 | Ga0466710_210500_583_837 | 84 |
| 77 | 3300042615 | Ga0466711_481016 | Ga0466711_481016_3899_4153 | 84 |
| 78 | 3300042616 | Ga0466715_011915 | Ga0466715_011915_4380_4634 | 84 |
| 79 | 3300042616 | Ga0466715_124107 | Ga0466715_124107_48_302 | 84 |
| 80 | 3300042619 | Ga0466726_090880 | Ga0466726_090880_163_417 | 84 |
| 81 | 3300042620 | Ga0466728_271005 | Ga0466728_271005_1477_1731 | 84 |
| 82 | 3300042621 | Ga0466729_077731 | Ga0466729_077731_673_927 | 84 |
| 83 | 3300042621 | Ga0466729_086701 | Ga0466729_086701_469_723 | 84 |
| 84 | 3300042621 | Ga0466729_116285 | Ga0466729_116285_1182_1436 | 84 |
| 85 | 3300042621 | Ga0466729_122502 | Ga0466729_122502_1757_2011 | 84 |
| 86 | 3300042635 | Ga0466702_158330 | Ga0466702_158330_879_1133 | 84 |
| 87 | 3300042636 | Ga0466703_093645 | Ga0466703_093645_1476_1730 | 84 |
| 88 | 3300042636 | Ga0466703_120282 | Ga0466703_120282_1161_1415 | 84 |
| 89 | 3300042636 | Ga0466703_200852 | Ga0466703_200852_2674_2928 | 84 |
| 90 | 3300042636 | Ga0466703_239492 | Ga0466703_239492_2896_3150 | 84 |
| 91 | 3300042643 | Ga0466704_055205 | Ga0466704_055205_1246_1500 | 84 |
| 92 | 3300042643 | Ga0466704_105898 | Ga0466704_105898_31_285 | 84 |
| 93 | 3300042643 | Ga0466704_578001 | Ga0466704_578001_2651_2905 | 84 |
| 94 | 3300042648 | Ga0466709_148383 | Ga0466709_148383_14501_14755 | 84 |
| 95 | 3300042652 | Ga0466708_062802 | Ga0466708_062802_38080_38334 | 84 |
| 96 | 3300042652 | Ga0466708_300420 | Ga0466708_300420_966_1220 | 84 |
| 97 | 3300042652 | Ga0466708_335294 | Ga0466708_335294_678_932 | 84 |
| 98 | 3300042655 | Ga0466727_330731 | Ga0466727_330731_2421_2675 | 84 |
| 99 | iso_pr_bacteria | 2820822094 | 2820822693 | 84 |
| 100 | iso_pr_bacteria | 2820823448 | 2820824879 | 84 |
| 101 | iso_pr_bacteria | 2820836992 | 2820837336 | 84 |
| 102 | iso_pr_bacteria | 2820848511 | 2820849166 | 84 |
| 103 | iso_pr_bacteria | 2820917597 | 2820917690 | 84 |
| 104 | 3300002462 | JGI24702J35022_10912793 | JGI24702J35022_109127932 | 85 |
| 105 | 3300002504 | JGI24705J35276_12210943 | JGI24705J35276_122109432 | 85 |
| 106 | 3300002834 | JGI24696J40584_12828452 | JGI24696J40584_128284522 | 85 |
| 107 | 3300005071 | Ga0068302_10069727 | Ga0068302_100697278 | 85 |
| 108 | 3300010049 | Ga0123356_10990798 | Ga0123356_109907982 | 85 |
| 109 | 3300010049 | Ga0123356_11682692 | Ga0123356_116826922 | 85 |
| 110 | 3300010049 | Ga0123356_12901258 | Ga0123356_129012581 | 85 |
| 111 | 3300010167 | Ga0123353_10193071 | Ga0123353_101930714 | 85 |
| 112 | 3300010167 | Ga0123353_11147928 | Ga0123353_111479282 | 85 |
| 113 | 3300010882 | Ga0123354_10031845 | Ga0123354_100318452 | 85 |
| 114 | 3300042599 | Ga0466706_035461 | Ga0466706_035461_202_459 | 85 |
| 115 | 3300042615 | Ga0466711_065069 | Ga0466711_065069_19586_19843 | 85 |
| 116 | 3300042617 | Ga0466718_134653 | Ga0466718_134653_4325_4582 | 85 |
| 117 | 3300042622 | Ga0466731_195106 | Ga0466731_195106_329_586 | 85 |
| 118 | iso_pr_bacteria | 2820831444 | 2820831553 | 85 |
| 119 | iso_pr_bacteria | 2820833147 | 2820833552 | 85 |
| 120 | iso_pr_bacteria | 2820907832 | 2820909489 | 85 |
| 121 | iso_pr_bacteria | 2820916033 | 2820916311 | 85 |
| 122 | iso_pr_bacteria | 2820941830 | 2820942184 | 85 |
| 123 | iso_pr_bacteria | 2820942695 | 2820943394 | 85 |
| 124 | iso_pr_bacteria | 2820951912 | 2820952677 | 85 |
| 125 | iso_pr_bacteria | 2821322763 | 2821323592 | 85 |
| 126 | 3300002462 | JGI24702J35022_10096611 | JGI24702J35022_100966113 | 86 |
| 127 | 3300009784 | Ga0123357_10014245 | Ga0123357_100142456 | 86 |
| 128 | 3300009784 | Ga0123357_10028873 | Ga0123357_100288735 | 86 |
| 129 | 3300009784 | Ga0123357_10066729 | Ga0123357_100667294 | 86 |
| 130 | 3300009826 | Ga0123355_10984814 | Ga0123355_109848143 | 86 |
| 131 | 3300009826 | Ga0123355_12066379 | Ga0123355_120663792 | 86 |
| 132 | 3300010049 | Ga0123356_10002929 | Ga0123356_100029297 | 86 |
| 133 | 3300010882 | Ga0123354_10000051 | Ga0123354_1000005140 | 86 |
| 134 | 3300010882 | Ga0123354_10366405 | Ga0123354_103664052 | 86 |
| 135 | 3300010882 | Ga0123354_10543217 | Ga0123354_105432172 | 86 |
| 136 | 3300042602 | Ga0466713_033853 | Ga0466713_033853_16967_17227 | 86 |
| 137 | 3300009784 | Ga0123357_10867568 | Ga0123357_108675681 | 87 |
| 138 | 3300010049 | Ga0123356_12332408 | Ga0123356_123324081 | 87 |
| 139 | 3300042591 | Ga0466692_169654 | Ga0466692_169654_2990_3253 | 87 |
| 140 | 3300042598 | Ga0466701_043882 | Ga0466701_043882_964_1227 | 87 |
| 141 | 3300042615 | Ga0466711_059144 | Ga0466711_059144_1728_1991 | 87 |
| 142 | iso_pr_bacteria | 2820870086 | 2820871209 | 87 |
| 143 | iso_pr_bacteria | 2820873081 | 2820874163 | 87 |
| 144 | iso_pr_bacteria | 2820880921 | 2820882090 | 87 |
| 145 | iso_pr_bacteria | 2820893114 | 2820894397 | 87 |
| 146 | iso_pr_bacteria | 2820934415 | 2820935452 | 87 |
| 147 | iso_pr_bacteria | 2820939604 | 2820940381 | 87 |
| 148 | iso_pr_bacteria | 2820940989 | 2820941422 | 87 |
| 149 | 3300002834 | JGI24696J40584_12926246 | JGI24696J40584_129262463 | 88 |
| 150 | 3300009826 | Ga0123355_10000146 | Ga0123355_1000014646 | 88 |
| 151 | 3300009826 | Ga0123355_10000884 | Ga0123355_100008845 | 88 |
| 152 | 3300009826 | Ga0123355_10001283 | Ga0123355_1000128334 | 88 |
| 153 | 3300009826 | Ga0123355_10009738 | Ga0123355_1000973813 | 88 |
| 154 | 3300009826 | Ga0123355_10012264 | Ga0123355_1001226416 | 88 |
| 155 | 3300009826 | Ga0123355_10017803 | Ga0123355_100178035 | 88 |
| 156 | 3300009826 | Ga0123355_10084225 | Ga0123355_100842255 | 88 |
| 157 | 3300009826 | Ga0123355_12162601 | Ga0123355_121626012 | 88 |
| 158 | 3300010167 | Ga0123353_10042430 | Ga0123353_100424304 | 88 |
| 159 | 3300010167 | Ga0123353_10078600 | Ga0123353_100786003 | 88 |
| 160 | 3300010167 | Ga0123353_10371221 | Ga0123353_103712212 | 88 |
| 161 | 3300010167 | Ga0123353_10819088 | Ga0123353_108190882 | 88 |
| 162 | 3300010167 | Ga0123353_11840728 | Ga0123353_118407282 | 88 |
| 163 | 3300010167 | Ga0123353_12480063 | Ga0123353_124800631 | 88 |
| 164 | 3300038395 | Ga0415639_256394 | Ga0415639_256394_250_516 | 88 |
| 165 | 3300042617 | Ga0466718_017658 | Ga0466718_017658_48730_48996 | 88 |
| 166 | 2225789004 | 2227108583 | 2227496035 | 92 |
| 167 | 3300042622 | Ga0466731_337668 | Ga0466731_337668_360_638 | 92 |
| 168 | 3300002462 | JGI24702J35022_10275303 | JGI24702J35022_102753032 | 93 |
| 169 | 3300005201 | Ga0072941_1696148 | Ga0072941_16961482 | 93 |
| 170 | 3300005201 | Ga0072941_1298217 | Ga0072941_12982172 | 94 |
| 171 | 3300042594 | Ga0466694_215823 | Ga0466694_215823_70_354 | 94 |
| 172 | 3300042600 | Ga0466700_234709 | Ga0466700_234709_7004_7288 | 94 |
| 173 | 3300042617 | Ga0466718_058599 | Ga0466718_058599_300_584 | 94 |
| 174 | 3300042623 | Ga0466734_065075 | Ga0466734_065075_3074_3358 | 94 |
| 175 | iso_pr_bacteria | 2820950349 | 2820950602 | 94 |
| 176 | 3300002462 | JGI24702J35022_10001985 | JGI24702J35022_1000198512 | 95 |
| 177 | 3300002462 | JGI24702J35022_10058886 | JGI24702J35022_100588863 | 95 |
| 178 | 3300002504 | JGI24705J35276_12116865 | JGI24705J35276_121168651 | 95 |
| 179 | 3300010167 | Ga0123353_10006900 | Ga0123353_1000690017 | 95 |
| 180 | 3300010167 | Ga0123353_10097722 | Ga0123353_100977224 | 95 |
| 181 | 3300010167 | Ga0123353_10196377 | Ga0123353_101963772 | 95 |
| 182 | 3300010167 | Ga0123353_10383923 | Ga0123353_103839232 | 95 |
| 183 | 3300042594 | Ga0466694_293851 | Ga0466694_293851_513_800 | 95 |
| 184 | 3300042619 | Ga0466726_176554 | Ga0466726_176554_6216_6503 | 95 |
| 185 | 3300042611 | Ga0466697_061174 | Ga0466697_061174_673_963 | 96 |
| 186 | 3300042617 | Ga0466718_064874 | Ga0466718_064874_538_843 | 101 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01016 | Ribosomal_L27 | Ribosomal L27 protein | 19 | 95 | 0.95 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8 | 0.969 | 37 | 100 |
| 6ywv-assembly1.cif.gz_R | The structure of the Atp25 bound assembly intermediate of the mitoribosome from Neurospora crassa | 0.95 | 36 | 97 |
| 8apo-assembly1.cif.gz_Au | Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites | 0.945 | 35 | 99 |
| 6ywy-assembly1.cif.gz_R | The structure of the mitoribosome from Neurospora crassa with bound tRNA at the P-site | 0.942 | 36 | 99 |
| 6yws-assembly1.cif.gz_R | The structure of the large subunit of the mitoribosome from Neurospora crassa | 0.94 | 36 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9685 | 37 | 100 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9406 | 37 | 101 | 2.40.50.100 |
| af_O59821_2_44_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9158 | 46 | 85 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8782 | 46 | 97 | 2.40.50.100 |
| af_Q9U0I4_44_103_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8559 | 45 | 101 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382C6Q8-F1-model_v4 | Ribosomal protein L27 | 0.9848 | 38 | 100 |
GO:0022625
GO:0003735 GO:0006412 |
| AF-A0A139DSC6-F1-model_v4 | Uncharacterized/unreviewed | 0.9724 | 37 | 100 | |
| AF-A0A7Y5TEY2-F1-model_v4 | Uncharacterized/unreviewed | 0.9695 | 37 | 98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.6 | 0.78 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.