Protein Family IF07905

Metagenome Isolate
166 Members
74 Samples
147 Scaffolds
215.83 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_049821|Ga0466718_049821_14886_15584
Length
232 aa
Sequence
MTDVKNIIAARAAKELKDGDVVNLGIGIPTLVVNFLPPGIDIILQSENGIMGMGPTPSSGEVNMDIVNAGGLPVTVKKGAAFFDSATSFGIIRGGHVDATIMGALEVDEKGNISNWIVPGKTIPGMGGAMDLAAAAKKVIVAMTHTRKDAPKILKNCTLPFTALGVVDMIITEMGVMEITPDGIVLTELHPDFTKEQIQEATGVNLIISPDLKPMAIGSNVFDPDSRFPAPH

📊 Sample Types

Isolate 11.4%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.7%
Kalotermitidae 20.3%
Coreidae 11.6%
Unclassified 10.1%
Rhinotermitidae 5.8%
Termopsidae 5.8%
Culicidae 2.9%
Hydrophilidae 1.4%
Drosophilidae 1.4%
Scarabaeidae 1.4%
Passalidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
18 8102117041 Caballeronia sp. INML3 Isolate Coreidae
19 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
23 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
27 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
28 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
37 8102102351 Caballeronia sp. INML1 Isolate Coreidae
38 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
39 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
44 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
48 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
49 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
50 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
51 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
52 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 8102109360 Caballeronia sp. INML2 Isolate Coreidae
57 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
58 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
59 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
60 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
61 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
62 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
64 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
65 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
66 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
67 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
68 8102124461 Caballeronia sp. INML3B Isolate Coreidae
69 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
70 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
71 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
72 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
73 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
74 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_185101 3300042656 Bacteria 3681
2 JGI24698J34947_10009448 3300002449 Bacteria 5352
3 JGI24698J34947_10056965 3300002449 Bacteria 1941
4 Ga0072941_1048289 3300005201 Bacteria 12919
5 Ga0466715_035814 3300042616 Bacteria 3688
6 Ga0466718_130445 3300042617 Bacteria 1040
7 Ga0466723_319690 3300042618 Bacteria 8383
8 Ga0466728_307464 3300042620 Bacteria 2239
9 Ga0466735_007504 3300042624 Bacteria 7602
10 Ga0466735_153971 3300042624 Bacteria 1415
11 Ga0466727_144429 3300042655 Bacteria 1150
12 Ga0466690_176250 3300042590 Bacteria 1510
13 Ga0466691_100981 3300042593 Bacteria 7051
14 Ga0466714_093319 3300042603 Bacteria 1881
15 Ga0466719_337699 3300042606 Bacteria 3956
16 Ga0466720_203829 3300042607 Bacteria 3874
17 Ga0123356_10069306 3300010049 Bacteria 3307
18 Ga0123353_10196713 3300010167 Bacteria 3177
19 Ga0123353_11304730 3300010167 Bacteria 942
20 Ga0466705_004229 3300042612 Bacteria 1694
21 Ga0466705_103215 3300042612 Bacteria 7213
22 Ga0466732_273868 3300042656 Bacteria 2011
23 AustNasuHG_c1010385 3300000089 Bacteria 3245
24 Ga0074263_105238 3300005485 Bacteria 3596
25 Ga0466712_028252 3300042614 Bacteria 3496
26 Ga0466718_024243 3300042617 Bacteria 2870
27 Ga0466718_032587 3300042617 Bacteria 3251
28 Ga0466704_045497 3300042643 Bacteria 37022
29 Ga0456237_0002427 3300041968 Unclassified 3016
30 Ga0466692_036479 3300042591 Bacteria 8250
31 Ga0466701_003696 3300042598 Bacteria 2027
32 Ga0466720_051023 3300042607 Bacteria 19706
33 Ga0123357_10439135 3300009784 Bacteria 1144
34 Ga0123355_10606544 3300009826 Bacteria 1296
35 Ga0123355_10865275 3300009826 Bacteria 991
36 Ga0466732_099962 3300042656 Bacteria 27941
37 IMNBL1DRAFT_c0013825 3300000062 Bacteria 3595
38 AustNasuHG_c1014353 3300000089 Bacteria 2697
39 JGI24698J34947_10012332 3300002449 Bacteria 4684
40 JGI24698J34947_10026622 3300002449 Bacteria 3072
41 JGI24695J34938_10000418 3300002450 Bacteria 41411
42 Ga0466712_262439 3300042614 Bacteria 14129
43 Ga0466711_092268 3300042615 Bacteria 3577
44 Ga0466715_074488 3300042616 Bacteria 7840
45 Ga0466718_167658 3300042617 Bacteria 9976
46 Ga0466728_030000 3300042620 Bacteria 13175
47 Ga0466692_161586 3300042591 Bacteria 2779
48 Ga0466707_050021 3300042601 Bacteria 3639
49 Ga0466719_192266 3300042606 Bacteria 6231
50 Ga0466720_107517 3300042607 Bacteria 53647
51 Ga0466722_239653 3300042609 Bacteria 1872
52 Ga0123353_10854566 3300010167 Unclassified 1247
53 Ga0123354_10104970 3300010882 Bacteria 3784
54 Ga0466732_049629 3300042656 Bacteria 22386
55 JGI24702J35022_10005416 3300002462 Bacteria 7468
56 Ga0466712_092920 3300042614 Bacteria 1254
57 Ga0466715_309330 3300042616 Bacteria 5953
58 Ga0466718_034918 3300042617 Bacteria 3345
59 Ga0466718_046944 3300042617 Bacteria 23335
60 Ga0466726_322769 3300042619 Bacteria 1148
61 Ga0466729_135047 3300042621 Bacteria 31219
62 Ga0466703_351562 3300042636 Unclassified 1451
63 Ga0466704_399241 3300042643 Bacteria 15889
64 Ga0466727_055243 3300042655 Bacteria 2088
65 Ga0160441_103155 3300012825 Bacteria 2936
66 Ga0160431_105879 3300012828 Bacteria 1956
67 Ga0466690_045686 3300042590 Bacteria 1203
68 Ga0466692_089700 3300042591 Bacteria 1081
69 Ga0466691_153164 3300042593 Bacteria 6452
70 Ga0466713_069033 3300042602 Bacteria 130314
71 Ga0466722_064750 3300042609 Bacteria 3038
72 Ga0466722_102291 3300042609 Bacteria 2612
73 Ga0123356_10557277 3300010049 Bacteria 1308
74 Ga0466697_150845 3300042611 Bacteria 1186
75 Ga0466733_095429 3300042659 Bacteria 17535
76 AustNasuHG_c1000978 3300000089 Bacteria 10300
77 JGI24695J34938_10056471 3300002450 Bacteria 1692
78 Ga0072941_1047601 3300005201 Bacteria 6334
79 Ga0074263_115099 3300005485 Bacteria 2119
80 Ga0466726_362632 3300042619 Bacteria 6547
81 Ga0123357_10085307 3300009784 Bacteria 4135
82 Ga0123353_10907941 3300010167 Bacteria 1198
83 Ga0123353_11338406 3300010167 Bacteria 926
84 Ga0466705_074632 3300042612 Bacteria 22401
85 Ga0466732_414836 3300042656 Bacteria 4785
86 Ga0466733_196545 3300042659 Bacteria 2227
87 JGI24698J34947_10050968 3300002449 Bacteria 2085
88 JGI24705J35276_12223495 3300002504 Bacteria 2515
89 Ga0072941_1017217 3300005201 Bacteria 7344
90 Ga0466712_059886 3300042614 Bacteria 32530
91 Ga0466718_049821 3300042617 Bacteria 16731
92 Ga0466734_090241 3300042623 Bacteria 1350
93 Ga0466704_283318 3300042643 Bacteria 1983
94 Ga0466709_406372 3300042648 Bacteria 7785
95 Ga0466656_004021 3300042550 Bacteria 1704
96 Ga0466692_008841 3300042591 Bacteria 5314
97 Ga0466692_050627 3300042591 Bacteria 1815
98 Ga0466692_096131 3300042591 Bacteria 2371
99 Ga0466692_104119 3300042591 Bacteria 1897
100 Ga0466719_460965 3300042606 Bacteria 1129
101 Ga0466720_018561 3300042607 Bacteria 1415
102 Ga0123353_10333161 3300010167 Unclassified 2296
103 Ga0123353_11541278 3300010167 Bacteria 843
104 Ga0466705_106416 3300042612 Unclassified 1073
105 JGI24700J35501_10918580 3300002508 Bacteria 4290
106 Ga0068302_10191429 3300005071 Bacteria 2623
107 Ga0072941_1027767 3300005201 Bacteria 1686
108 Ga0466712_319953 3300042614 Bacteria 9383
109 Ga0466718_047621 3300042617 Bacteria 7333
110 Ga0466718_073000 3300042617 Bacteria 36315
111 Ga0466718_102600 3300042617 Bacteria 17725
112 Ga0466718_130668 3300042617 Bacteria 3232
113 Ga0466718_161589 3300042617 Bacteria 41024
114 Ga0466723_159293 3300042618 Bacteria 2631
115 Ga0466723_329899 3300042618 Bacteria 3066
116 Ga0466704_190371 3300042643 Bacteria 2127
117 Ga0160460_101953 3300012845 Bacteria 5578
118 Ga0466690_012460 3300042590 Bacteria 15225
119 Ga0466692_037332 3300042591 Bacteria 3469
120 Ga0466692_181390 3300042591 Bacteria 19604
121 Ga0466700_085580 3300042600 Bacteria 1083
122 Ga0466700_168422 3300042600 Bacteria 1534
123 Ga0466707_294340 3300042601 Bacteria 1208
124 Ga0466720_087563 3300042607 Bacteria 11752
125 JGI24697J35500_11272933 3300002507 Bacteria 5255
126 Ga0072941_1005857 3300005201 Bacteria 2987
127 Ga0072941_1029279 3300005201 Bacteria 9606
128 Ga0466715_001017 3300042616 Bacteria 12101
129 Ga0466718_001494 3300042617 Bacteria 1919
130 Ga0466718_046836 3300042617 Bacteria 2989
131 Ga0466726_046977 3300042619 Bacteria 4709
132 Ga0466726_048733 3300042619 Bacteria 1192
133 Ga0466709_285329 3300042648 Bacteria 6327
134 Ga0466708_109111 3300042652 Bacteria 12786
135 Ga0466708_394662 3300042652 Bacteria 1081
136 Ga0160446_100459 3300012835 Bacteria 18457
137 Ga0466657_147126 3300042582 Bacteria 8091
138 Ga0466692_035522 3300042591 Unclassified 5956
139 Ga0466692_154859 3300042591 Bacteria 5317
140 Ga0466694_383607 3300042594 Bacteria 2461
141 Ga0466696_452408 3300042596 Bacteria 2046
142 Ga0466714_002266 3300042603 Bacteria 1278
143 Ga0466714_030104 3300042603 Bacteria 1564
144 Ga0466716_219621 3300042605 Bacteria 13242
145 Ga0466722_196751 3300042609 Bacteria 5186
146 Ga0123353_10145779 3300010167 Bacteria 3785
147 Ga0123354_10333260 3300010882 Unclassified 1380

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_168422 Ga0466700_168422_39_599 186
2 3300010167 Ga0123353_10854566 Ga0123353_108545662 195
3 3300042659 Ga0466733_196545 Ga0466733_196545_218_808 196
4 3300042624 Ga0466735_153971 Ga0466735_153971_302_961 198
5 3300010167 Ga0123353_11541278 Ga0123353_115412782 202
6 3300042621 Ga0466729_135047 Ga0466729_135047_22897_23553 202
7 3300005201 Ga0072941_1029279 Ga0072941_10292799 204
8 3300010167 Ga0123353_10333161 Ga0123353_103331612 205
9 3300010882 Ga0123354_10333260 Ga0123354_103332602 206
10 3300042612 Ga0466705_106416 Ga0466705_106416_344_1006 207
11 3300042550 Ga0466656_004021 Ga0466656_004021_457_1083 208
12 3300042582 Ga0466657_147126 Ga0466657_147126_2238_2864 208
13 3300042603 Ga0466714_030104 Ga0466714_030104_857_1483 208
14 3300009826 Ga0123355_10606544 Ga0123355_106065442 211
15 3300041968 Ga0456237_0002427 Ga0456237_0002427_157_792 211
16 3300042591 Ga0466692_050627 Ga0466692_050627_951_1586 211
17 3300042591 Ga0466692_089700 Ga0466692_089700_205_840 211
18 3300042591 Ga0466692_096131 Ga0466692_096131_1259_1894 211
19 3300042591 Ga0466692_104119 Ga0466692_104119_849_1484 211
20 3300042609 Ga0466722_239653 Ga0466722_239653_914_1549 211
21 3300042616 Ga0466715_309330 Ga0466715_309330_3846_4481 211
22 iso_pr_bacteria 2848356102 2848357021 211
23 3300010167 Ga0123353_10907941 Ga0123353_109079411 212
24 3300042591 Ga0466692_035522 Ga0466692_035522_3319_3957 212
25 iso_pr_bacteria 2873589062 2873591347 212
26 3300042609 Ga0466722_064750 Ga0466722_064750_37_678 213
27 3300042611 Ga0466697_150845 Ga0466697_150845_343_984 213
28 3300042591 Ga0466692_036479 Ga0466692_036479_1632_2276 214
29 3300042603 Ga0466714_093319 Ga0466714_093319_439_1083 214
30 3300042612 Ga0466705_103215 Ga0466705_103215_4274_4918 214
31 3300042616 Ga0466715_035814 Ga0466715_035814_1955_2599 214
32 3300042617 Ga0466718_032587 Ga0466718_032587_1957_2601 214
33 3300042618 Ga0466723_329899 Ga0466723_329899_1415_2059 214
34 3300042619 Ga0466726_322769 Ga0466726_322769_16_660 214
35 3300042619 Ga0466726_362632 Ga0466726_362632_2973_3617 214
36 3300042620 Ga0466728_307464 Ga0466728_307464_934_1578 214
37 3300042636 Ga0466703_351562 Ga0466703_351562_354_998 214
38 3300042648 Ga0466709_285329 Ga0466709_285329_4409_5053 214
39 3300042655 Ga0466727_144429 Ga0466727_144429_390_1034 214
40 iso_pr_bacteria 2767802234 2769329263 214
41 iso_pr_bacteria 2820483401 2820484587 214
42 3300002450 JGI24695J34938_10056471 JGI24695J34938_100564712 215
43 3300009784 Ga0123357_10085307 Ga0123357_100853074 215
44 3300009784 Ga0123357_10439135 Ga0123357_104391352 215
45 3300009826 Ga0123355_10865275 Ga0123355_108652752 215
46 3300010049 Ga0123356_10557277 Ga0123356_105572771 215
47 3300010167 Ga0123353_10196713 Ga0123353_101967132 215
48 3300010167 Ga0123353_11304730 Ga0123353_113047302 215
49 3300042591 Ga0466692_008841 Ga0466692_008841_505_1152 215
50 3300042617 Ga0466718_130445 Ga0466718_130445_333_980 215
51 3300042659 Ga0466733_095429 Ga0466733_095429_5918_6565 215
52 3300000062 IMNBL1DRAFT_c0013825 IMNBL1DRAFT_00138252 216
53 3300002450 JGI24695J34938_10000418 JGI24695J34938_100004187 216
54 3300005201 Ga0072941_1005857 Ga0072941_10058573 216
55 3300005201 Ga0072941_1027767 Ga0072941_10277673 216
56 3300010167 Ga0123353_10145779 Ga0123353_101457794 216
57 3300042590 Ga0466690_176250 Ga0466690_176250_660_1310 216
58 3300042591 Ga0466692_037332 Ga0466692_037332_862_1512 216
59 3300042591 Ga0466692_154859 Ga0466692_154859_2849_3499 216
60 3300042591 Ga0466692_161586 Ga0466692_161586_515_1165 216
61 3300042591 Ga0466692_181390 Ga0466692_181390_936_1586 216
62 3300042594 Ga0466694_383607 Ga0466694_383607_1038_1688 216
63 3300042598 Ga0466701_003696 Ga0466701_003696_643_1293 216
64 3300042600 Ga0466700_085580 Ga0466700_085580_151_801 216
65 3300042606 Ga0466719_192266 Ga0466719_192266_3751_4401 216
66 3300042606 Ga0466719_337699 Ga0466719_337699_1608_2258 216
67 3300042607 Ga0466720_107517 Ga0466720_107517_34341_34991 216
68 3300042609 Ga0466722_196751 Ga0466722_196751_1776_2426 216
69 3300042614 Ga0466712_092920 Ga0466712_092920_328_978 216
70 3300042616 Ga0466715_074488 Ga0466715_074488_4616_5266 216
71 3300042617 Ga0466718_046836 Ga0466718_046836_1768_2418 216
72 3300042617 Ga0466718_073000 Ga0466718_073000_28846_29496 216
73 3300042617 Ga0466718_130668 Ga0466718_130668_390_1040 216
74 3300042617 Ga0466718_167658 Ga0466718_167658_3761_4411 216
75 3300042618 Ga0466723_159293 Ga0466723_159293_1951_2601 216
76 3300042619 Ga0466726_046977 Ga0466726_046977_3224_3874 216
77 3300042619 Ga0466726_048733 Ga0466726_048733_264_914 216
78 3300042620 Ga0466728_030000 Ga0466728_030000_9083_9733 216
79 3300042623 Ga0466734_090241 Ga0466734_090241_626_1276 216
80 3300042643 Ga0466704_283318 Ga0466704_283318_1045_1695 216
81 3300042643 Ga0466704_399241 Ga0466704_399241_9862_10512 216
82 3300042648 Ga0466709_406372 Ga0466709_406372_6151_6801 216
83 3300042652 Ga0466708_394662 Ga0466708_394662_364_1014 216
84 3300042655 Ga0466727_055243 Ga0466727_055243_1418_2068 216
85 3300042656 Ga0466732_099962 Ga0466732_099962_16274_16924 216
86 3300042656 Ga0466732_273868 Ga0466732_273868_387_1037 216
87 iso_pr_bacteria 2781125631 2781268970 216
88 iso_pr_bacteria 2781125631 2781269258 216
89 iso_pr_bacteria 2781125692 2781432340 216
90 iso_pr_bacteria 8018750880 8018752665 216
91 iso_pr_bacteria 8018754795 8018758147 216
92 3300000089 AustNasuHG_c1010385 AustNasuHG_10103852 217
93 3300000089 AustNasuHG_c1014353 AustNasuHG_10143532 217
94 3300002462 JGI24702J35022_10005416 JGI24702J35022_100054162 217
95 3300002504 JGI24705J35276_12223495 JGI24705J35276_122234953 217
96 3300005071 Ga0068302_10191429 Ga0068302_101914292 217
97 3300005485 Ga0074263_105238 Ga0074263_1052384 217
98 3300010882 Ga0123354_10104970 Ga0123354_101049702 217
99 3300042590 Ga0466690_045686 Ga0466690_045686_197_850 217
100 3300042593 Ga0466691_100981 Ga0466691_100981_1793_2446 217
101 3300042593 Ga0466691_153164 Ga0466691_153164_1259_1912 217
102 3300042596 Ga0466696_452408 Ga0466696_452408_364_1017 217
103 3300042603 Ga0466714_002266 Ga0466714_002266_215_868 217
104 3300042606 Ga0466719_460965 Ga0466719_460965_441_1094 217
105 3300042612 Ga0466705_074632 Ga0466705_074632_11180_11833 217
106 3300042615 Ga0466711_092268 Ga0466711_092268_1155_1808 217
107 3300042616 Ga0466715_001017 Ga0466715_001017_138_791 217
108 3300042617 Ga0466718_001494 Ga0466718_001494_150_803 217
109 3300042617 Ga0466718_024243 Ga0466718_024243_1684_2337 217
110 3300042617 Ga0466718_034918 Ga0466718_034918_2159_2812 217
111 3300042617 Ga0466718_046944 Ga0466718_046944_4986_5639 217
112 3300042617 Ga0466718_047621 Ga0466718_047621_1466_2119 217
113 3300042617 Ga0466718_102600 Ga0466718_102600_8654_9307 217
114 3300042617 Ga0466718_161589 Ga0466718_161589_12778_13431 217
115 3300042643 Ga0466704_045497 Ga0466704_045497_24456_25109 217
116 3300042656 Ga0466732_049629 Ga0466732_049629_6575_7228 217
117 3300042656 Ga0466732_185101 Ga0466732_185101_2499_3152 217
118 3300042656 Ga0466732_414836 Ga0466732_414836_3219_3872 217
119 3300002449 JGI24698J34947_10050968 JGI24698J34947_100509682 218
120 3300002507 JGI24697J35500_11272933 JGI24697J35500_112729333 218
121 3300005201 Ga0072941_1047601 Ga0072941_10476015 218
122 3300005201 Ga0072941_1048289 Ga0072941_10482893 218
123 3300042601 Ga0466707_050021 Ga0466707_050021_684_1340 218
124 3300042602 Ga0466713_069033 Ga0466713_069033_83286_83942 218
125 3300042614 Ga0466712_028252 Ga0466712_028252_489_1145 218
126 3300042614 Ga0466712_059886 Ga0466712_059886_13758_14414 218
127 3300042614 Ga0466712_262439 Ga0466712_262439_5232_5888 218
128 3300042614 Ga0466712_319953 Ga0466712_319953_3964_4620 218
129 3300042618 Ga0466723_319690 Ga0466723_319690_1464_2120 218
130 3300042624 Ga0466735_007504 Ga0466735_007504_2089_2745 218
131 3300042643 Ga0466704_190371 Ga0466704_190371_1340_1996 218
132 iso_pr_bacteria 2819994798 2819995099 218
133 iso_pr_bacteria 8025708040 8025709206 218
134 iso_pr_bacteria 8078130113 8078131270 218
135 iso_pr_bacteria 8102102351 8102103446 218
136 iso_pr_bacteria 8102109360 8102110546 218
137 iso_pr_bacteria 8102117041 8102118102 218
138 iso_pr_bacteria 8102124461 8102125725 218
139 iso_pr_bacteria 8102138357 8102139445 218
140 iso_pr_bacteria 8102193924 8102195089 218
141 3300002449 JGI24698J34947_10009448 JGI24698J34947_100094483 219
142 3300002449 JGI24698J34947_10012332 JGI24698J34947_100123325 219
143 3300002449 JGI24698J34947_10056965 JGI24698J34947_100569653 219
144 3300002508 JGI24700J35501_10918580 JGI24700J35501_109185803 219
145 3300005201 Ga0072941_1017217 Ga0072941_10172176 219
146 3300042601 Ga0466707_294340 Ga0466707_294340_495_1154 219
147 3300042607 Ga0466720_087563 Ga0466720_087563_2278_2937 219
148 3300042609 Ga0466722_102291 Ga0466722_102291_1901_2560 219
149 3300012845 Ga0160460_101953 Ga0160460_1019532 220
150 3300042607 Ga0466720_018561 Ga0466720_018561_183_845 220
151 3300042612 Ga0466705_004229 Ga0466705_004229_344_1006 220
152 3300042652 Ga0466708_109111 Ga0466708_109111_454_1116 220
153 3300000089 AustNasuHG_c1000978 AustNasuHG_10009783 221
154 3300005485 Ga0074263_115099 Ga0074263_1150993 221
155 3300042590 Ga0466690_012460 Ga0466690_012460_1508_2173 221
156 3300042605 Ga0466716_219621 Ga0466716_219621_10419_11084 221
157 3300002449 JGI24698J34947_10026622 JGI24698J34947_100266223 222
158 3300010049 Ga0123356_10069306 Ga0123356_100693064 222
159 3300042607 Ga0466720_051023 Ga0466720_051023_13028_13729 222
160 iso_pr_bacteria 2781125694 2781436202 224
161 3300042607 Ga0466720_203829 Ga0466720_203829_459_1142 227
162 3300010167 Ga0123353_11338406 Ga0123353_113384061 230
163 3300012825 Ga0160441_103155 Ga0160441_1031553 231
164 3300012828 Ga0160431_105879 Ga0160431_1058792 231
165 3300042617 Ga0466718_049821 Ga0466718_049821_14886_15584 232
166 3300012835 Ga0160446_100459 Ga0160446_10045910 243

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01144 CoA_trans Coenzyme A transferase 8 200 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01144 GO:0008410 CoA-transferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.