Protein Family IF07894

Metagenome Isolate
169 Members
34 Samples
165 Scaffolds
613.3 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_037272|Ga0466718_037272_2676_4751
Length
691 aa
Sequence
VFACGDKTKDNHADYRAENTYIYVYIIAPLMLRILSEAGGHFKKIQNCHNLAIITSYNCGMETAEEQGLQKRSFSIGGMYCVNCQNIIEKELKNTAGIKDAKVNYKTTAASVTYDTAITSFDKISAVIESLGYKTLEENSKNTVTQIIGTLVIILALFMLMRSFTTSKLAAAFPLAQEGMSYGMLLVIGLFTSVHCIAMCGGINLSQTLRKNGELGVGSGEQGKEKSTSTNTYSTLLPSFLYNGGRLVSYTAVGVLVGALGSVITLSGHFQGVVQLVAGVFMVIMGINMLGLFPSLRRFIPQMPAKLQEGLTSLFAKKIDGQKTGRGPLVVGFLNGFMPCGPLQAMQVYALSTGSPVRGGISMFLFCAGTIPLMFALGAVSSALSGTKGQAFSRHVMQIGAVLVAALGLVMFSSGWTLSGFANPLDKAAYLKPASAQTAGNAFIPVIQNGVQIVNSTLLPNRYPAITVQQGIPVRWIINAPPGSINGCNNRMIIREYGIQYTFKQGGNVIEFTPAKAGRFRYSCWMAMIHSTITVLAEGESVADVREPDTAPKPAGVEIPTDAVAIAQIADNAQTVTIRLTDDGFDPAIVVMQRRLPALWTITIDSIDPGNSSIIFPAYYAIMETGQGENQLQLVPRDDFEFYTADSIFYGYVKVVNDITRVNVEAVKEEAANFETLIYPQAYFDAAYGGY

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 43.8%
Termitidae 28.1%
Unclassified 18.8%
Rhinotermitidae 6.2%
Termopsidae 3.1%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
2 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
3 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
15 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
16 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
17 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
18 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
19 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_028727 3300042636 Bacteria 8419
2 Ga0466712_053999 3300042614 Bacteria 11777
3 Ga0466712_122592 3300042614 Bacteria 4432
4 Ga0466712_317150 3300042614 Unclassified 17236
5 Ga0466711_172387 3300042615 Bacteria 13096
6 Ga0466711_353133 3300042615 Bacteria 6253
7 Ga0466715_196957 3300042616 Bacteria 7264
8 Ga0466715_321699 3300042616 Bacteria 15126
9 Ga0466718_086031 3300042617 Bacteria 11178
10 Ga0264413_106601 3300024493 Bacteria 27928
11 Ga0466699_036090 3300042597 Bacteria 3764
12 Ga0466699_258954 3300042597 Bacteria 11627
13 Ga0466719_148396 3300042606 Bacteria 8595
14 Ga0466719_152688 3300042606 Bacteria 2423
15 Ga0466720_135247 3300042607 Bacteria 17099
16 Ga0466722_181559 3300042609 Bacteria 13685
17 JGI24698J34947_10000779 3300002449 Bacteria 15815
18 JGI24698J34947_10025705 3300002449 Bacteria 3132
19 JGI24698J34947_10044720 3300002449 Bacteria 2264
20 Ga0466705_254645 3300042612 Bacteria 3746
21 Ga0466704_032707 3300042643 Bacteria 9282
22 Ga0466704_047359 3300042643 Bacteria 4746
23 Ga0466704_125342 3300042643 Bacteria 11447
24 Ga0466704_428240 3300042643 Bacteria 14598
25 Ga0466712_261145 3300042614 Bacteria 13881
26 Ga0466712_284237 3300042614 Bacteria 8418
27 Ga0466690_209720 3300042590 Bacteria 5606
28 Ga0466699_090719 3300042597 Bacteria 11658
29 Ga0466699_305929 3300042597 Bacteria 25158
30 Ga0466720_044286 3300042607 Bacteria 6044
31 JGI24698J34947_10000008 3300002449 Bacteria 53028
32 JGI24698J34947_10006760 3300002449 Bacteria 6300
33 JGI24698J34947_10007028 3300002449 Unclassified 6187
34 JGI24698J34947_10022077 3300002449 Bacteria 3416
35 Ga0072941_1032238 3300005201 Bacteria 6016
36 Ga0466705_332606 3300042612 Bacteria 6087
37 Ga0466703_032152 3300042636 Bacteria 12033
38 Ga0466708_370005 3300042652 Bacteria 4577
39 Ga0466712_065504 3300042614 Bacteria 13077
40 Ga0466712_104880 3300042614 Bacteria 22225
41 Ga0466712_116358 3300042614 Bacteria 6793
42 Ga0466712_271950 3300042614 Bacteria 20534
43 Ga0466715_138077 3300042616 Bacteria 28303
44 Ga0466715_394631 3300042616 Bacteria 4086
45 Ga0466718_012692 3300042617 Bacteria 11382
46 Ga0466718_037272 3300042617 Bacteria 9825
47 Ga0466723_012081 3300042618 Bacteria 14979
48 Ga0466723_129920 3300042618 Bacteria 8113
49 Ga0466726_285300 3300042619 Bacteria 11106
50 Ga0466728_347710 3300042620 Bacteria 42490
51 Ga0466719_416536 3300042606 Bacteria 3777
52 Ga0466720_054034 3300042607 Bacteria 19093
53 JGI24698J34947_10009368 3300002449 Bacteria 5377
54 JGI24698J34947_10010137 3300002449 Unclassified 5164
55 JGI24698J34947_10018708 3300002449 Bacteria 3741
56 Ga0072941_1098620 3300005201 Bacteria 2637
57 Ga0466705_067474 3300042612 Bacteria 5445
58 Ga0466732_015118 3300042656 Bacteria 10235
59 Ga0466732_023874 3300042656 Bacteria 9258
60 Ga0466703_357153 3300042636 Bacteria 2628
61 Ga0466712_028563 3300042614 Bacteria 25335
62 Ga0466712_116817 3300042614 Bacteria 4965
63 Ga0466712_123870 3300042614 Bacteria 3499
64 Ga0466712_247226 3300042614 Bacteria 7840
65 Ga0466715_516407 3300042616 Bacteria 6436
66 Ga0466718_063315 3300042617 Bacteria 2992
67 Ga0466718_099906 3300042617 Bacteria 5330
68 Ga0466723_146995 3300042618 Bacteria 13213
69 Ga0466728_245942 3300042620 Bacteria 7142
70 Ga0466691_054012 3300042593 Bacteria 4338
71 Ga0466694_166767 3300042594 Bacteria 3133
72 AustNasuHG_c1003739 3300000089 Bacteria 5488
73 JGI24698J34947_10002453 3300002449 Bacteria 9995
74 JGI24698J34947_10014868 3300002449 Bacteria 4239
75 JGI24698J34947_10023065 3300002449 Bacteria 3330
76 Ga0072941_1000967 3300005201 Bacteria 66192
77 Ga0466732_414195 3300042656 Bacteria 7038
78 Ga0466703_143438 3300042636 Bacteria 5772
79 Ga0466704_191460 3300042643 Bacteria 34072
80 Ga0466709_335357 3300042648 Bacteria 5469
81 Ga0466708_167340 3300042652 Bacteria 11142
82 Ga0466712_111253 3300042614 Bacteria 12401
83 Ga0466711_202959 3300042615 Bacteria 30412
84 Ga0466715_345203 3300042616 Bacteria 7760
85 Ga0466718_036770 3300042617 Bacteria 4345
86 Ga0466718_037691 3300042617 Bacteria 4480
87 Ga0466723_067687 3300042618 Bacteria 2691
88 Ga0466690_036134 3300042590 Bacteria 12565
89 Ga0466699_240707 3300042597 Bacteria 23866
90 Ga0466699_430522 3300042597 Bacteria 4354
91 Ga0466719_374911 3300042606 Bacteria 28594
92 Ga0466719_455820 3300042606 Bacteria 2893
93 Ga0466722_115318 3300042609 Bacteria 10822
94 AustNasuHG_c1000751 3300000089 Bacteria 11548
95 JGI24698J34947_10005585 3300002449 Bacteria 6900
96 JGI24698J34947_10008408 3300002449 Unclassified 5666
97 Ga0466703_199435 3300042636 Bacteria 8606
98 Ga0466703_253997 3300042636 Bacteria 12715
99 Ga0466708_365429 3300042652 Bacteria 22126
100 Ga0466705_398946 3300042612 Bacteria 3277
101 Ga0466712_078299 3300042614 Bacteria 23319
102 Ga0466711_110592 3300042615 Bacteria 12346
103 Ga0466715_570575 3300042616 Bacteria 20092
104 Ga0466718_031919 3300042617 Bacteria 6787
105 Ga0466726_018611 3300042619 Bacteria 4600
106 Ga0466726_034944 3300042619 Bacteria 3282
107 Ga0466726_361805 3300042619 Bacteria 4724
108 Ga0264413_114001 3300024493 Bacteria 4022
109 Ga0466691_045640 3300042593 Bacteria 12384
110 Ga0466691_222207 3300042593 Bacteria 2835
111 Ga0466694_202227 3300042594 Bacteria 6112
112 Ga0466699_012857 3300042597 Bacteria 9542
113 Ga0466716_489603 3300042605 Bacteria 4389
114 Ga0466719_328459 3300042606 Bacteria 19533
115 Ga0466719_575206 3300042606 Bacteria 2174
116 JGI24698J34947_10000917 3300002449 Bacteria 14958
117 JGI24698J34947_10005680 3300002449 Bacteria 6839
118 Ga0072941_1011494 3300005201 Bacteria 16608
119 Ga0072941_1196351 3300005201 Bacteria 2680
120 Ga0466703_086023 3300042636 Bacteria 4279
121 Ga0466704_109196 3300042643 Bacteria 4971
122 Ga0466712_023260 3300042614 Bacteria 5021
123 Ga0466712_079617 3300042614 Bacteria 3773
124 Ga0466712_160998 3300042614 Bacteria 9598
125 Ga0466711_068893 3300042615 Bacteria 5420
126 Ga0466711_087554 3300042615 Bacteria 4825
127 Ga0466718_009083 3300042617 Bacteria 13571
128 Ga0466718_061986 3300042617 Bacteria 2861
129 Ga0466718_076722 3300042617 Bacteria 5204
130 Ga0466718_146622 3300042617 Bacteria 2160
131 Ga0466723_038665 3300042618 Bacteria 29336
132 Ga0466728_319510 3300042620 Bacteria 10364
133 Ga0466691_104642 3300042593 Bacteria 3964
134 Ga0466696_090887 3300042596 Bacteria 7406
135 Ga0466699_044599 3300042597 Bacteria 15860
136 Ga0466713_042258 3300042602 Bacteria 18185
137 Ga0466716_149094 3300042605 Bacteria 7326
138 Ga0466719_538625 3300042606 Bacteria 3437
139 Ga0466722_067692 3300042609 Bacteria 7988
140 AustNasuHG_c1001906 3300000089 Bacteria 7509
141 JGI24698J34947_10002406 3300002449 Bacteria 10071
142 JGI24698J34947_10005774 3300002449 Bacteria 6787
143 JGI24698J34947_10022817 3300002449 Bacteria 3351
144 JGI24698J34947_10023219 3300002449 Bacteria 3319
145 Ga0072940_1004397 3300005200 Bacteria 3229
146 Ga0072941_1023996 3300005201 Bacteria 18890
147 Ga0466705_160338 3300042612 Bacteria 5845
148 Ga0466712_002197 3300042614 Bacteria 12926
149 Ga0466712_070731 3300042614 Bacteria 4826
150 Ga0466712_170826 3300042614 Bacteria 11484
151 Ga0466712_182291 3300042614 Bacteria 19649
152 Ga0466718_023038 3300042617 Bacteria 7069
153 Ga0466718_029432 3300042617 Bacteria 6340
154 Ga0466723_003931 3300042618 Bacteria 68756
155 Ga0466723_163120 3300042618 Bacteria 30495
156 Ga0264413_116171 3300024493 Bacteria 2368
157 Ga0466692_109739 3300042591 Bacteria 3112
158 Ga0466691_108780 3300042593 Unclassified 3353
159 Ga0466707_029176 3300042601 Bacteria 3193
160 Ga0466707_225544 3300042601 Bacteria 3967
161 AustNasuHG_c1000271 3300000089 Bacteria 17744
162 JGI24698J34947_10006692 3300002449 Bacteria 6328
163 JGI24698J34947_10012754 3300002449 Bacteria 4599
164 JGI24698J34947_10014654 3300002449 Bacteria 4270
165 Ga0072941_1038045 3300005201 Bacteria 9790

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1196351 Ga0072941_11963513 551
2 3300005201 Ga0072941_1023996 Ga0072941_102399613 553
3 3300042609 Ga0466722_067692 Ga0466722_067692_1509_3428 559
4 3300042614 Ga0466712_182291 Ga0466712_182291_15440_17215 559
5 3300042615 Ga0466711_068893 Ga0466711_068893_3311_5053 567
6 3300042593 Ga0466691_054012 Ga0466691_054012_2311_4077 569
7 3300042617 Ga0466718_146622 Ga0466718_146622_38_1864 569
8 3300002449 JGI24698J34947_10022077 JGI24698J34947_100220772 571
9 3300005201 Ga0072941_1098620 Ga0072941_10986202 571
10 3300042606 Ga0466719_538625 Ga0466719_538625_582_2426 571
11 3300042614 Ga0466712_261145 Ga0466712_261145_11476_13302 572
12 3300042643 Ga0466704_109196 Ga0466704_109196_1634_3493 574
13 3300005201 Ga0072941_1000967 Ga0072941_100096712 577
14 3300042597 Ga0466699_090719 Ga0466699_090719_3246_5042 578
15 3300002449 JGI24698J34947_10000008 JGI24698J34947_1000000847 579
16 3300042597 Ga0466699_430522 Ga0466699_430522_1178_3106 580
17 3300042597 Ga0466699_240707 Ga0466699_240707_19061_20842 581
18 3300042609 Ga0466722_181559 Ga0466722_181559_457_2307 582
19 3300005201 Ga0072941_1038045 Ga0072941_10380454 583
20 3300042612 Ga0466705_398946 Ga0466705_398946_1166_3052 583
21 3300042614 Ga0466712_111253 Ga0466712_111253_836_2674 585
22 3300042612 Ga0466705_067474 Ga0466705_067474_25_1998 586
23 3300042652 Ga0466708_365429 Ga0466708_365429_18271_20127 586
24 3300042636 Ga0466703_086023 Ga0466703_086023_458_2341 587
25 3300002449 JGI24698J34947_10022817 JGI24698J34947_100228172 588
26 3300042619 Ga0466726_018611 Ga0466726_018611_1695_3521 588
27 3300042618 Ga0466723_003931 Ga0466723_003931_29485_31347 589
28 3300002449 JGI24698J34947_10006760 JGI24698J34947_100067604 590
29 3300002449 JGI24698J34947_10023065 JGI24698J34947_100230652 590
30 3300005200 Ga0072940_1004397 Ga0072940_10043972 590
31 3300005201 Ga0072941_1032238 Ga0072941_10322382 591
32 3300042643 Ga0466704_428240 Ga0466704_428240_3934_5712 592
33 3300002449 JGI24698J34947_10008408 JGI24698J34947_100084082 593
34 3300002449 JGI24698J34947_10018708 JGI24698J34947_100187083 593
35 3300042597 Ga0466699_012857 Ga0466699_012857_5643_7580 596
36 3300042618 Ga0466723_163120 Ga0466723_163120_22517_24436 596
37 3300002449 JGI24698J34947_10000917 JGI24698J34947_100009174 597
38 3300042614 Ga0466712_065504 Ga0466712_065504_10327_12120 597
39 3300042614 Ga0466712_247226 Ga0466712_247226_1117_2910 597
40 3300042597 Ga0466699_258954 Ga0466699_258954_2925_4793 598
41 3300042607 Ga0466720_044286 Ga0466720_044286_1143_3086 598
42 3300042614 Ga0466712_116817 Ga0466712_116817_697_2496 599
43 3300002449 JGI24698J34947_10023219 JGI24698J34947_100232192 600
44 3300042619 Ga0466726_034944 Ga0466726_034944_339_2159 600
45 3300042601 Ga0466707_225544 Ga0466707_225544_1724_3532 602
46 3300042614 Ga0466712_078299 Ga0466712_078299_12105_13913 602
47 3300042636 Ga0466703_032152 Ga0466703_032152_1601_3445 602
48 3300042652 Ga0466708_167340 Ga0466708_167340_1049_2896 602
49 3300042605 Ga0466716_489603 Ga0466716_489603_978_2882 603
50 3300042618 Ga0466723_129920 Ga0466723_129920_3828_5675 603
51 3300042614 Ga0466712_116358 Ga0466712_116358_1662_3512 604
52 3300042614 Ga0466712_284237 Ga0466712_284237_5913_7760 604
53 3300042614 Ga0466712_317150 Ga0466712_317150_11670_13484 604
54 iso_pr_bacteria 2820727601 2820728745 605
55 3300042614 Ga0466712_023260 Ga0466712_023260_249_2069 606
56 3300002449 JGI24698J34947_10009368 JGI24698J34947_100093681 607
57 3300042615 Ga0466711_202959 Ga0466711_202959_26121_27977 607
58 3300042620 Ga0466728_319510 Ga0466728_319510_974_2839 607
59 3300042636 Ga0466703_253997 Ga0466703_253997_2626_4530 607
60 3300002449 JGI24698J34947_10010137 JGI24698J34947_100101373 609
61 3300042612 Ga0466705_332606 Ga0466705_332606_2097_3980 609
62 3300042614 Ga0466712_070731 Ga0466712_070731_804_2633 609
63 3300002449 JGI24698J34947_10025705 JGI24698J34947_100257053 610
64 3300042612 Ga0466705_160338 Ga0466705_160338_3327_5159 610
65 3300042617 Ga0466718_009083 Ga0466718_009083_2813_4720 610
66 3300042597 Ga0466699_305929 Ga0466699_305929_18252_20087 611
67 3300042601 Ga0466707_029176 Ga0466707_029176_389_2224 611
68 3300042602 Ga0466713_042258 Ga0466713_042258_7382_9262 611
69 3300042615 Ga0466711_110592 Ga0466711_110592_5982_7862 611
70 3300042652 Ga0466708_370005 Ga0466708_370005_388_2337 611
71 3300042594 Ga0466694_202227 Ga0466694_202227_722_2560 612
72 3300042614 Ga0466712_028563 Ga0466712_028563_5945_7783 612
73 3300042607 Ga0466720_135247 Ga0466720_135247_5605_7479 613
74 3300042614 Ga0466712_160998 Ga0466712_160998_5596_7437 613
75 3300042656 Ga0466732_015118 Ga0466732_015118_5345_7186 613
76 3300042607 Ga0466720_054034 Ga0466720_054034_5861_7705 614
77 3300042614 Ga0466712_079617 Ga0466712_079617_956_2839 614
78 3300042617 Ga0466718_029432 Ga0466718_029432_222_2066 614
79 3300042643 Ga0466704_125342 Ga0466704_125342_5763_7793 614
80 3300042656 Ga0466732_023874 Ga0466732_023874_3791_5635 614
81 3300042614 Ga0466712_002197 Ga0466712_002197_4809_6656 615
82 3300042614 Ga0466712_104880 Ga0466712_104880_922_2805 615
83 3300002449 JGI24698J34947_10002453 JGI24698J34947_100024537 616
84 3300042594 Ga0466694_166767 Ga0466694_166767_1177_3027 616
85 3300042618 Ga0466723_146995 Ga0466723_146995_3730_5580 616
86 3300042636 Ga0466703_199435 Ga0466703_199435_3315_5165 616
87 3300002449 JGI24698J34947_10002406 JGI24698J34947_100024067 617
88 3300002449 JGI24698J34947_10014654 JGI24698J34947_100146543 617
89 3300042606 Ga0466719_374911 Ga0466719_374911_7749_9602 617
90 3300042616 Ga0466715_138077 Ga0466715_138077_15800_17695 617
91 3300042618 Ga0466723_038665 Ga0466723_038665_9876_11729 617
92 3300000089 AustNasuHG_c1000751 AustNasuHG_10007516 618
93 3300002449 JGI24698J34947_10012754 JGI24698J34947_100127543 618
94 3300042617 Ga0466718_023038 Ga0466718_023038_5093_6949 618
95 3300042620 Ga0466728_245942 Ga0466728_245942_1164_3020 618
96 3300002449 JGI24698J34947_10005680 JGI24698J34947_100056805 619
97 3300042597 Ga0466699_044599 Ga0466699_044599_8417_10423 619
98 3300042614 Ga0466712_271950 Ga0466712_271950_8808_10703 619
99 3300042615 Ga0466711_353133 Ga0466711_353133_4102_5961 619
100 3300042614 Ga0466712_123870 Ga0466712_123870_772_2634 620
101 3300042616 Ga0466715_196957 Ga0466715_196957_4406_6271 621
102 3300042617 Ga0466718_012692 Ga0466718_012692_6886_8751 621
103 3300002449 JGI24698J34947_10044720 JGI24698J34947_100447202 622
104 3300042605 Ga0466716_149094 Ga0466716_149094_4204_6072 622
105 3300042616 Ga0466715_321699 Ga0466715_321699_2135_4003 622
106 3300042618 Ga0466723_067687 Ga0466723_067687_748_2616 622
107 3300024493 Ga0264413_114001 Ga0264413_1140013 623
108 3300042614 Ga0466712_053999 Ga0466712_053999_8469_10430 623
109 3300042643 Ga0466704_047359 Ga0466704_047359_422_2293 623
110 3300042656 Ga0466732_414195 Ga0466732_414195_1479_3350 623
111 3300024493 Ga0264413_106601 Ga0264413_1066019 624
112 3300042648 Ga0466709_335357 Ga0466709_335357_3090_4964 624
113 3300002449 JGI24698J34947_10005774 JGI24698J34947_100057742 625
114 3300042590 Ga0466690_209720 Ga0466690_209720_3045_4922 625
115 3300042618 Ga0466723_012081 Ga0466723_012081_12171_14096 625
116 3300042619 Ga0466726_361805 Ga0466726_361805_2306_4291 625
117 3300042606 Ga0466719_148396 Ga0466719_148396_4377_6296 626
118 3300042616 Ga0466715_394631 Ga0466715_394631_1658_3538 626
119 3300042617 Ga0466718_061986 Ga0466718_061986_273_2153 626
120 3300042617 Ga0466718_063315 Ga0466718_063315_219_2099 626
121 3300042636 Ga0466703_143438 Ga0466703_143438_426_2366 626
122 3300000089 AustNasuHG_c1003739 AustNasuHG_10037393 627
123 3300042606 Ga0466719_152688 Ga0466719_152688_127_2010 627
124 3300042619 Ga0466726_285300 Ga0466726_285300_5153_7036 627
125 3300042614 Ga0466712_170826 Ga0466712_170826_578_2464 628
126 3300042615 Ga0466711_087554 Ga0466711_087554_712_2640 628
127 3300042617 Ga0466718_031919 Ga0466718_031919_1442_3400 628
128 3300000089 AustNasuHG_c1000271 AustNasuHG_10002717 629
129 3300002449 JGI24698J34947_10000779 JGI24698J34947_100007794 629
130 3300042593 Ga0466691_045640 Ga0466691_045640_10054_11943 629
131 3300042606 Ga0466719_328459 Ga0466719_328459_13636_15525 629
132 3300042636 Ga0466703_028727 Ga0466703_028727_3363_5252 629
133 3300042643 Ga0466704_191460 Ga0466704_191460_18235_20124 629
134 3300002449 JGI24698J34947_10005585 JGI24698J34947_100055855 630
135 3300042615 Ga0466711_172387 Ga0466711_172387_6816_8708 630
136 iso_pr_bacteria 2819992462 2819993406 630
137 iso_pr_bacteria 2820020240 2820021309 630
138 3300042597 Ga0466699_036090 Ga0466699_036090_1065_2960 631
139 3300042617 Ga0466718_099906 Ga0466718_099906_2747_4735 631
140 3300042593 Ga0466691_108780 Ga0466691_108780_175_2073 632
141 3300042606 Ga0466719_575206 Ga0466719_575206_58_1956 632
142 3300042617 Ga0466718_036770 Ga0466718_036770_44_1993 632
143 3300005201 Ga0072941_1011494 Ga0072941_10114943 633
144 3300042590 Ga0466690_036134 Ga0466690_036134_3534_5435 633
145 3300042614 Ga0466712_122592 Ga0466712_122592_1429_3330 633
146 3300042593 Ga0466691_222207 Ga0466691_222207_300_2204 634
147 3300000089 AustNasuHG_c1001906 AustNasuHG_10019064 635
148 3300042606 Ga0466719_455820 Ga0466719_455820_825_2732 635
149 3300042591 Ga0466692_109739 Ga0466692_109739_215_2125 636
150 3300042616 Ga0466715_516407 Ga0466715_516407_4010_5920 636
151 3300042617 Ga0466718_086031 Ga0466718_086031_128_2038 636
152 3300042643 Ga0466704_032707 Ga0466704_032707_7022_8932 636
153 3300042616 Ga0466715_570575 Ga0466715_570575_15392_17353 637
154 3300042617 Ga0466718_037691 Ga0466718_037691_44_1960 638
155 3300024493 Ga0264413_116171 Ga0264413_1161712 641
156 3300042609 Ga0466722_115318 Ga0466722_115318_5539_7467 642
157 3300042617 Ga0466718_076722 Ga0466718_076722_3061_4989 642
158 3300042620 Ga0466728_347710 Ga0466728_347710_892_2880 644
159 iso_pr_bacteria 2772190978 2773731139 645
160 3300042616 Ga0466715_345203 Ga0466715_345203_5509_7509 647
161 3300042612 Ga0466705_254645 Ga0466705_254645_623_2569 648
162 3300002449 JGI24698J34947_10007028 JGI24698J34947_100070284 649
163 3300002449 JGI24698J34947_10006692 JGI24698J34947_100066923 652
164 3300002449 JGI24698J34947_10014868 JGI24698J34947_100148683 652
165 3300042636 Ga0466703_357153 Ga0466703_357153_229_2214 653
166 3300042596 Ga0466696_090887 Ga0466696_090887_1809_3773 654
167 3300042606 Ga0466719_416536 Ga0466719_416536_979_3060 666
168 3300042593 Ga0466691_104642 Ga0466691_104642_137_2149 670
169 3300042617 Ga0466718_037272 Ga0466718_037272_2676_4751 691

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00403 HMA Heavy-metal-associated domain 74 134 0.98
PF13386 DsbD_2 Cytochrome C biogenesis protein transmembrane region 185 409 0.85
PF02683 DsbD Cytochrome C biogenesis protein transmembrane region 222 412 0.76

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00403 GO:0046872 metal ion binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.54 0.62 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.