Protein Family IF07862

Metagenome Isolate
138 Members
48 Samples
132 Scaffolds
171.1 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_004473|Ga0466718_004473_100_702
Length
200 aa
Sequence
MFDKLVKINCFSKNRILKYFAKNLLEKLYCCEINCIEIDKSVLFAHHARGCTIIASKICENVVILQNVTIGTNMKFNRINNEWENIGNPIICKKVVIADGAKILGPIIIGENSFVAAGAIVTKDMPANSIIYGINQFKPKDINYDFVFNSNMIKFEKIIEANNKLIAKYGETVSFGMNNQETFVNNLSVDSNGNSLFTKK

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 30.4%
Termitidae 26.1%
Unclassified 8.7%
Termopsidae 8.7%
Rhinotermitidae 8.7%
Tenebrionidae 6.5%
Passalidae 6.5%
Scarabaeidae 4.3%

🌳 Taxonomy

Archaea 1
Bacteria 116
Eukaryota 0
Viruses 1
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
11 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
12 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
17 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
20 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
27 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
44 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
45 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
46 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_077023 3300042614 Bacteria 8216
2 Ga0466718_133863 3300042617 Bacteria 3725
3 Ga0466729_207086 3300042621 Bacteria 1878
4 Ga0466703_331555 3300042636 Bacteria 3071
5 Ga0466703_365377 3300042636 Unclassified 3733
6 Ga0466709_217249 3300042648 Bacteria 1744
7 Ga0466720_116173 3300042607 Bacteria 6086
8 Ga0466722_125210 3300042609 Bacteria 1989
9 Ga0466711_080309 3300042615 Bacteria 6939
10 Ga0466715_159884 3300042616 Bacteria 1069
11 Ga0466723_004129 3300042618 Bacteria 5294
12 Ga0466726_018414 3300042619 Archaea 48773
13 Ga0466735_013676 3300042624 Bacteria 7918
14 Ga0466704_260938 3300042643 Bacteria 2021
15 Ga0466727_275809 3300042655 Bacteria 4694
16 Ga0466698_051060 3300042610 Bacteria 1008
17 Ga0466698_383574 3300042610 Bacteria 1992
18 Ga0466698_388294 3300042610 Unclassified 2291
19 JGI24698J34947_10043253 3300002449 Unclassified 2310
20 Ga0068302_10327410 3300005071 Bacteria 1329
21 Ga0123354_10244859 3300010882 Bacteria 1834
22 Ga0562379_4078 3300056790 Bacteria 8170
23 Ga0562375_0425 3300056856 Unclassified 92367
24 Ga0466718_004473 3300042617 Bacteria 1315
25 Ga0466718_048169 3300042617 Unclassified 9748
26 Ga0466718_131103 3300042617 Unclassified 2229
27 Ga0466729_222326 3300042621 Bacteria 9193
28 Ga0466729_267225 3300042621 Bacteria 7101
29 Ga0466704_494562 3300042643 Unclassified 1994
30 Ga0466704_542045 3300042643 Bacteria 3303
31 Ga0466707_336397 3300042601 Bacteria 1217
32 Ga0466716_334639 3300042605 Bacteria 3595
33 Ga0123357_10125550 3300009784 Bacteria 3216
34 Ga0466705_081179 3300042612 Bacteria 19501
35 Ga0562375_0352 3300056856 Bacteria 106463
36 Ga0466691_158540 3300042593 Bacteria 5043
37 Ga0466711_150193 3300042615 Bacteria 5387
38 Ga0466718_010515 3300042617 Bacteria 22531
39 Ga0466718_068923 3300042617 Bacteria 5984
40 Ga0466718_098737 3300042617 Bacteria 7926
41 Ga0466728_027651 3300042620 Bacteria 1644
42 Ga0466729_307582 3300042621 Bacteria 11189
43 Ga0466704_070710 3300042643 Bacteria 14004
44 Ga0466727_011196 3300042655 Bacteria 9723
45 Ga0466727_342344 3300042655 Bacteria 1163
46 Ga0466707_332464 3300042601 Bacteria 1242
47 Ga0466720_191140 3300042607 Bacteria 11274
48 Ga0466722_100813 3300042609 Bacteria 34081
49 Ga0466698_496145 3300042610 Bacteria 1423
50 IMNBGM34_c001352 3300000036 Bacteria 4337
51 IMNBL1DRAFT_c0000509 3300000062 Bacteria 31993
52 IMNBL1DRAFT_c0087516 3300000062 Bacteria 860
53 JGI24698J34947_10039291 3300002449 Bacteria 2450
54 JGI24698J34947_10123079 3300002449 Unclassified 1122
55 Ga0466705_087333 3300042612 Unclassified 1260
56 Ga0466705_259764 3300042612 Bacteria 108301
57 Ga0466690_067238 3300042590 Bacteria 3359
58 Ga0466690_297509 3300042590 Bacteria 2453
59 Ga0466696_282823 3300042596 Bacteria 1832
60 Ga0466711_318209 3300042615 Viruses 1540
61 Ga0466711_381740 3300042615 Unclassified 1926
62 Ga0466718_041059 3300042617 Bacteria 14369
63 Ga0466729_034475 3300042621 Bacteria 9914
64 Ga0466735_183924 3300042624 Bacteria 2046
65 Ga0466703_167334 3300042636 Bacteria 1549
66 Ga0466704_494932 3300042643 Bacteria 3480
67 Ga0466709_020318 3300042648 Bacteria 1172
68 Ga0466707_090019 3300042601 Bacteria 6773
69 Ga0466707_385524 3300042601 Bacteria 4384
70 Ga0466719_488791 3300042606 Bacteria 2806
71 Ga0466720_210696 3300042607 Bacteria 2310
72 Ga0466698_459188 3300042610 Bacteria 1900
73 JGI24699J35502_11118281 3300002509 Bacteria 3085
74 JGI24699J35502_11133614 3300002509 Bacteria 12538
75 Ga0072940_1017641 3300005200 Bacteria 746
76 Ga0562377_0071 3300056842 Bacteria 439264
77 Ga0562375_1921 3300056856 Bacteria 25384
78 Ga0264413_119345 3300024493 Unclassified 3874
79 Ga0466712_161949 3300042614 Bacteria 2690
80 Ga0466718_035710 3300042617 Bacteria 2697
81 Ga0466723_209313 3300042618 Bacteria 3992
82 Ga0466735_127902 3300042624 Bacteria 4663
83 Ga0466703_060578 3300042636 Bacteria 45367
84 Ga0466703_375614 3300042636 Bacteria 2459
85 Ga0466704_073656 3300042643 Bacteria 1050
86 Ga0466707_317091 3300042601 Bacteria 75536
87 Ga0466707_330926 3300042601 Bacteria 2578
88 Ga0466719_552259 3300042606 Bacteria 2912
89 Ga0466720_208854 3300042607 Bacteria 1521
90 Ga0466698_468332 3300042610 Bacteria 1539
91 JGI24698J34947_10120354 3300002449 Unclassified 1140
92 JGI24698J34947_10137400 3300002449 Unclassified 1035
93 Ga0072940_1169564 3300005200 Bacteria 867
94 Ga0466705_075189 3300042612 Bacteria 1783
95 Ga0466690_083635 3300042590 Bacteria 1037
96 Ga0466693_072098 3300042592 Bacteria 2080
97 Ga0466693_267856 3300042592 Bacteria 2160
98 Ga0466699_132204 3300042597 Bacteria 1845
99 Ga0466712_167618 3300042614 Bacteria 10653
100 Ga0466712_232894 3300042614 Bacteria 12479
101 Ga0466712_323664 3300042614 Bacteria 6737
102 Ga0466718_082825 3300042617 Bacteria 1164
103 Ga0466723_090890 3300042618 Bacteria 4644
104 Ga0466729_172574 3300042621 Bacteria 3512
105 Ga0466735_169173 3300042624 Bacteria 2145
106 Ga0466703_353382 3300042636 Bacteria 28459
107 Ga0466704_361522 3300042643 Bacteria 8686
108 Ga0466704_510522 3300042643 Bacteria 4313
109 Ga0466707_223290 3300042601 Bacteria 57510
110 Ga0466719_348281 3300042606 Bacteria 1280
111 Ga0466698_147262 3300042610 Bacteria 1461
112 Ga0466698_331438 3300042610 Bacteria 1262
113 2227321900 2225789004 Bacteria 1187
114 2227484096 2225789004 Bacteria 4325
115 JGI24696J40584_12720060 3300002834 Unclassified 758
116 Ga0123357_10640638 3300009784 Bacteria 792
117 Ga0466692_141664 3300042591 Unclassified 5164
118 Ga0466711_271391 3300042615 Bacteria 1829
119 Ga0466715_018639 3300042616 Unclassified 6923
120 Ga0466735_107496 3300042624 Bacteria 8455
121 Ga0466703_073699 3300042636 Bacteria 16554
122 Ga0466704_509882 3300042643 Unclassified 1790
123 Ga0466708_140126 3300042652 Unclassified 1683
124 Ga0466707_046157 3300042601 Bacteria 13856
125 Ga0466707_188722 3300042601 Bacteria 65668
126 Ga0466719_195364 3300042606 Bacteria 3069
127 Ga0466720_159857 3300042607 Bacteria 7273
128 Ga0466698_066495 3300042610 Bacteria 1666
129 Ga0466698_497430 3300042610 Unclassified 1031
130 Ga0068305_10053439 3300005083 Bacteria 985
131 Ga0123357_10104928 3300009784 Unclassified 3627
132 Ga0123354_10292807 3300010882 Bacteria 1556

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_018639 Ga0466715_018639_3291_3767 140
2 3300042612 Ga0466705_259764 Ga0466705_259764_40148_40681 142
3 3300042652 Ga0466708_140126 Ga0466708_140126_922_1410 144
4 3300002449 JGI24698J34947_10043253 JGI24698J34947_100432532 152
5 3300042591 Ga0466692_141664 Ga0466692_141664_4635_5153 154
6 3300042605 Ga0466716_334639 Ga0466716_334639_1466_1987 155
7 3300042643 Ga0466704_070710 Ga0466704_070710_9827_10348 155
8 3300002449 JGI24698J34947_10120354 JGI24698J34947_101203542 156
9 3300002449 JGI24698J34947_10137400 JGI24698J34947_101374002 156
10 3300042614 Ga0466712_077023 Ga0466712_077023_6475_7002 157
11 3300042614 Ga0466712_161949 Ga0466712_161949_90_614 157
12 3300002449 JGI24698J34947_10123079 JGI24698J34947_101230792 158
13 3300042610 Ga0466698_383574 Ga0466698_383574_1086_1613 160
14 3300042590 Ga0466690_297509 Ga0466690_297509_1731_2252 161
15 3300042615 Ga0466711_271391 Ga0466711_271391_606_1127 161
16 3300042617 Ga0466718_068923 Ga0466718_068923_4617_5135 161
17 3300042621 Ga0466729_034475 Ga0466729_034475_705_1238 161
18 3300042643 Ga0466704_260938 Ga0466704_260938_568_1089 161
19 3300042648 Ga0466709_217249 Ga0466709_217249_62_580 161
20 3300042655 Ga0466727_011196 Ga0466727_011196_7680_8201 161
21 3300002509 JGI24699J35502_11133614 JGI24699J35502_111336142 162
22 3300042612 Ga0466705_087333 Ga0466705_087333_432_986 162
23 3300042614 Ga0466712_232894 Ga0466712_232894_5510_6034 162
24 3300042610 Ga0466698_066495 Ga0466698_066495_589_1137 163
25 3300042610 Ga0466698_147262 Ga0466698_147262_504_1031 163
26 3300042610 Ga0466698_459188 Ga0466698_459188_817_1341 163
27 3300042614 Ga0466712_323664 Ga0466712_323664_3941_4462 163
28 3300042636 Ga0466703_167334 Ga0466703_167334_451_996 163
29 3300042643 Ga0466704_494932 Ga0466704_494932_281_808 163
30 3300042643 Ga0466704_509882 Ga0466704_509882_671_1189 163
31 3300042643 Ga0466704_510522 Ga0466704_510522_2768_3328 163
32 3300042655 Ga0466727_342344 Ga0466727_342344_476_1009 163
33 3300056842 Ga0562377_0071 Ga0562377_0071_3699_4241 163
34 3300042597 Ga0466699_132204 Ga0466699_132204_1106_1636 164
35 3300042621 Ga0466729_267225 Ga0466729_267225_4617_5162 164
36 3300042648 Ga0466709_020318 Ga0466709_020318_503_1030 164
37 3300042601 Ga0466707_336397 Ga0466707_336397_271_819 165
38 3300042610 Ga0466698_331438 Ga0466698_331438_198_731 165
39 3300042621 Ga0466729_307582 Ga0466729_307582_9235_9780 165
40 3300042643 Ga0466704_542045 Ga0466704_542045_2050_2616 165
41 3300042655 Ga0466727_275809 Ga0466727_275809_2105_2632 165
42 3300005071 Ga0068302_10327410 Ga0068302_103274102 166
43 3300042610 Ga0466698_388294 Ga0466698_388294_778_1323 166
44 3300042617 Ga0466718_131103 Ga0466718_131103_138_704 166
45 3300042620 Ga0466728_027651 Ga0466728_027651_839_1339 166
46 2225789004 2227321900 2227770242 167
47 3300042615 Ga0466711_150193 Ga0466711_150193_4037_4591 167
48 3300056790 Ga0562379_4078 Ga0562379_4078_5196_5753 167
49 3300042636 Ga0466703_073699 Ga0466703_073699_15438_15980 168
50 3300042643 Ga0466704_073656 Ga0466704_073656_103_633 168
51 3300042593 Ga0466691_158540 Ga0466691_158540_1247_1756 169
52 3300042606 Ga0466719_348281 Ga0466719_348281_381_917 169
53 3300042612 Ga0466705_075189 Ga0466705_075189_340_900 169
54 3300042643 Ga0466704_494562 Ga0466704_494562_548_1105 169
55 3300010882 Ga0123354_10244859 Ga0123354_102448592 170
56 3300042618 Ga0466723_209313 Ga0466723_209313_909_1454 170
57 3300042601 Ga0466707_223290 Ga0466707_223290_920_1465 171
58 3300042610 Ga0466698_497430 Ga0466698_497430_244_789 171
59 3300042617 Ga0466718_010515 Ga0466718_010515_10999_11514 171
60 3300042617 Ga0466718_035710 Ga0466718_035710_1460_1975 171
61 3300042617 Ga0466718_082825 Ga0466718_082825_236_751 171
62 3300042617 Ga0466718_098737 Ga0466718_098737_1806_2321 171
63 3300042617 Ga0466718_133863 Ga0466718_133863_317_832 171
64 3300042621 Ga0466729_207086 Ga0466729_207086_705_1271 171
65 3300042636 Ga0466703_375614 Ga0466703_375614_823_1374 171
66 3300009784 Ga0123357_10125550 Ga0123357_101255503 172
67 3300009784 Ga0123357_10640638 Ga0123357_106406382 172
68 3300024493 Ga0264413_119345 Ga0264413_1193456 172
69 3300042601 Ga0466707_385524 Ga0466707_385524_2492_3046 172
70 3300042607 Ga0466720_116173 Ga0466720_116173_3888_4406 172
71 3300042607 Ga0466720_191140 Ga0466720_191140_8678_9196 172
72 3300042617 Ga0466718_041059 Ga0466718_041059_6818_7336 172
73 3300042618 Ga0466723_004129 Ga0466723_004129_618_1175 172
74 3300042607 Ga0466720_208854 Ga0466720_208854_702_1223 173
75 3300042610 Ga0466698_051060 Ga0466698_051060_347_868 173
76 3300042610 Ga0466698_496145 Ga0466698_496145_589_1137 173
77 3300042619 Ga0466726_018414 Ga0466726_018414_27493_28068 173
78 3300042624 Ga0466735_169173 Ga0466735_169173_1438_1959 173
79 3300042636 Ga0466703_060578 Ga0466703_060578_32482_33018 173
80 3300005200 Ga0072940_1017641 Ga0072940_10176411 174
81 3300042601 Ga0466707_330926 Ga0466707_330926_327_851 174
82 3300042614 Ga0466712_167618 Ga0466712_167618_6855_7379 174
83 iso_pr_bacteria 8007211731 8007212803 174
84 2225789004 2227484096 2227948122 175
85 3300002449 JGI24698J34947_10039291 JGI24698J34947_100392912 175
86 3300042590 Ga0466690_067238 Ga0466690_067238_2619_3146 175
87 3300042590 Ga0466690_083635 Ga0466690_083635_366_893 175
88 3300042592 Ga0466693_267856 Ga0466693_267856_204_731 175
89 3300042601 Ga0466707_317091 Ga0466707_317091_68882_69409 175
90 3300042601 Ga0466707_332464 Ga0466707_332464_643_1170 175
91 3300042606 Ga0466719_195364 Ga0466719_195364_1060_1587 175
92 3300042609 Ga0466722_100813 Ga0466722_100813_11689_12237 175
93 3300042609 Ga0466722_125210 Ga0466722_125210_682_1209 175
94 3300042612 Ga0466705_081179 Ga0466705_081179_1364_1891 175
95 3300042624 Ga0466735_107496 Ga0466735_107496_1485_2012 175
96 3300042624 Ga0466735_127902 Ga0466735_127902_2390_2917 175
97 3300002509 JGI24699J35502_11118281 JGI24699J35502_111182815 176
98 3300042607 Ga0466720_159857 Ga0466720_159857_6163_6693 176
99 3300042621 Ga0466729_172574 Ga0466729_172574_1773_2336 176
100 3300042624 Ga0466735_013676 Ga0466735_013676_7235_7765 176
101 iso_pr_bacteria 8114544644 8114544814 176
102 3300000036 IMNBGM34_c001352 IMNBGM34_0013524 177
103 3300042607 Ga0466720_210696 Ga0466720_210696_175_708 177
104 3300042610 Ga0466698_468332 Ga0466698_468332_895_1428 177
105 3300042617 Ga0466718_048169 Ga0466718_048169_3204_3791 177
106 3300042618 Ga0466723_090890 Ga0466723_090890_3031_3564 177
107 3300010882 Ga0123354_10292807 Ga0123354_102928072 178
108 3300042592 Ga0466693_072098 Ga0466693_072098_22_558 178
109 iso_pr_bacteria 2820757377 2820757757 178
110 3300000062 IMNBL1DRAFT_c0000509 IMNBL1DRAFT_00005091 179
111 3300002834 JGI24696J40584_12720060 JGI24696J40584_127200601 179
112 3300042601 Ga0466707_090019 Ga0466707_090019_2498_3037 179
113 3300042636 Ga0466703_365377 Ga0466703_365377_285_824 179
114 iso_pr_bacteria 8007215774 8007218497 179
115 3300000062 IMNBL1DRAFT_c0087516 IMNBL1DRAFT_00875162 180
116 3300005083 Ga0068305_10053439 Ga0068305_100534392 180
117 3300042606 Ga0466719_488791 Ga0466719_488791_538_1080 180
118 3300056856 Ga0562375_0352 Ga0562375_0352_34601_35143 180
119 3300056856 Ga0562375_0425 Ga0562375_0425_34033_34575 180
120 3300056856 Ga0562375_1921 Ga0562375_1921_16706_17248 180
121 iso_pr_bacteria 646311952 646430427 180
122 3300042601 Ga0466707_046157 Ga0466707_046157_262_807 181
123 3300042621 Ga0466729_222326 Ga0466729_222326_7458_8057 181
124 iso_pr_bacteria 2571042003 2571062770 181
125 3300005200 Ga0072940_1169564 Ga0072940_11695641 182
126 3300009784 Ga0123357_10104928 Ga0123357_101049282 182
127 3300042601 Ga0466707_188722 Ga0466707_188722_44206_44754 182
128 3300042615 Ga0466711_318209 Ga0466711_318209_872_1423 183
129 3300042636 Ga0466703_353382 Ga0466703_353382_14840_15391 183
130 3300042615 Ga0466711_381740 Ga0466711_381740_216_770 184
131 3300042616 Ga0466715_159884 Ga0466715_159884_21_575 184
132 3300042636 Ga0466703_331555 Ga0466703_331555_2349_2903 184
133 3300042624 Ga0466735_183924 Ga0466735_183924_916_1482 188
134 3300042596 Ga0466696_282823 Ga0466696_282823_270_842 190
135 3300042606 Ga0466719_552259 Ga0466719_552259_921_1502 193
136 3300042615 Ga0466711_080309 Ga0466711_080309_6068_6658 196
137 3300042643 Ga0466704_361522 Ga0466704_361522_7418_8032 197
138 3300042617 Ga0466718_004473 Ga0466718_004473_100_702 200

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 88 123 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.