Protein Family IF07858

Metagenome Isolate
152 Members
35 Samples
148 Scaffolds
223.89 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_000848|Ga0466718_000848_357_1094
Length
238 aa
Sequence
LDVPGHIPAFAYFAEQKKMMESLLSQPVCGILITIACYSLGLLIRKLLPSPLTNPLLIANVLIILVIACSPITIEQYLAGGNLISMFIGPVTVILALRIYRQRAQLKANIVPILGSCIAGSAASLISVWILCRLFGIDQVITVSMLPKSVTTAIALELSQRAGGLAGLTITTSASFSPFLIKIFKLNDPFAAGIAIGTSGHAIGTAAAIELGETQGAMSGLAMSISGIISAVIFILLF

πŸ“Š Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 42.4%
Termitidae 30.3%
Rhinotermitidae 9.1%
Termopsidae 9.1%
Unclassified 9.1%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
10 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
11 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
12 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
13 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
14 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
29 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_163351 3300042612 Bacteria 5125
2 Ga0466732_058009 3300042656 Bacteria 4564
3 Ga0466703_092275 3300042636 Bacteria 31222
4 Ga0466703_163398 3300042636 Bacteria 7981
5 Ga0466703_289535 3300042636 Unclassified 1014
6 Ga0466704_410758 3300042643 Bacteria 2049
7 Ga0466709_196245 3300042648 Bacteria 8436
8 Ga0466708_028939 3300042652 Bacteria 1457
9 Ga0466727_001812 3300042655 Bacteria 1813
10 Ga0466690_259352 3300042590 Bacteria 1065
11 Ga0466691_004554 3300042593 Bacteria 17680
12 Ga0466716_255161 3300042605 Bacteria 1284
13 Ga0466720_063956 3300042607 Bacteria 1037
14 Ga0466715_029750 3300042616 Bacteria 26276
15 Ga0466726_177337 3300042619 Bacteria 1198
16 Ga0466726_250790 3300042619 Bacteria 1571
17 Ga0466728_001579 3300042620 Bacteria 5789
18 Ga0072941_1043532 3300005201 Bacteria 2375
19 Ga0466703_109859 3300042636 Bacteria 14347
20 Ga0466704_027263 3300042643 Bacteria 1814
21 Ga0466708_384397 3300042652 Bacteria 13623
22 Ga0466708_456632 3300042652 Bacteria 1436
23 Ga0466727_012637 3300042655 Bacteria 2313
24 Ga0466727_067767 3300042655 Bacteria 2385
25 Ga0264413_133271 3300024493 Bacteria 2116
26 Ga0466690_203677 3300042590 Bacteria 4912
27 Ga0466692_049820 3300042591 Bacteria 6276
28 Ga0466716_451464 3300042605 Unclassified 2426
29 Ga0466719_004078 3300042606 Bacteria 6220
30 Ga0466705_420383 3300042612 Bacteria 1807
31 Ga0466711_373543 3300042615 Bacteria 3952
32 Ga0466715_299417 3300042616 Bacteria 33411
33 Ga0466723_046496 3300042618 Bacteria 11683
34 Ga0466728_117892 3300042620 Bacteria 10614
35 Ga0466732_351593 3300042656 Bacteria 1150
36 AustNasuHG_c1019004 3300000089 Bacteria 2260
37 Ga0072941_1031886 3300005201 Bacteria 9167
38 Ga0466735_068981 3300042624 Bacteria 1101
39 Ga0466703_114006 3300042636 Bacteria 11179
40 Ga0466703_133499 3300042636 Bacteria 24847
41 Ga0466703_388582 3300042636 Bacteria 16269
42 Ga0466704_069242 3300042643 Bacteria 9564
43 Ga0466704_120416 3300042643 Bacteria 30382
44 Ga0466709_207086 3300042648 Bacteria 9251
45 Ga0466727_255260 3300042655 Bacteria 3428
46 Ga0415639_152145 3300038395 Bacteria 2195
47 Ga0466690_150339 3300042590 Bacteria 1878
48 Ga0466692_198692 3300042591 Bacteria 2070
49 Ga0466696_201545 3300042596 Bacteria 1235
50 Ga0466716_255008 3300042605 Bacteria 8977
51 Ga0466716_413209 3300042605 Bacteria 10445
52 Ga0466719_490569 3300042606 Bacteria 4286
53 Ga0466722_077178 3300042609 Bacteria 7087
54 Ga0466705_526326 3300042612 Bacteria 11488
55 Ga0466712_212519 3300042614 Unclassified 4087
56 Ga0466715_168491 3300042616 Bacteria 7489
57 Ga0466735_118849 3300042624 Bacteria 1296
58 Ga0466704_417160 3300042643 Bacteria 44433
59 Ga0466708_353856 3300042652 Bacteria 7938
60 Ga0466727_262817 3300042655 Bacteria 1899
61 Ga0466692_019604 3300042591 Bacteria 3069
62 Ga0466691_047778 3300042593 Bacteria 3517
63 Ga0466696_445148 3300042596 Bacteria 16635
64 Ga0466711_194986 3300042615 Bacteria 8935
65 Ga0466711_282742 3300042615 Bacteria 9728
66 Ga0466715_291710 3300042616 Bacteria 15751
67 Ga0466715_544846 3300042616 Bacteria 4257
68 Ga0466723_156265 3300042618 Bacteria 2159
69 Ga0466723_216010 3300042618 Bacteria 5877
70 Ga0466726_251339 3300042619 Bacteria 1482
71 Ga0466705_039023 3300042612 Bacteria 5175
72 Ga0466703_367248 3300042636 Bacteria 2419
73 Ga0466709_124923 3300042648 Bacteria 7775
74 Ga0466709_215233 3300042648 Bacteria 2084
75 Ga0466709_354668 3300042648 Bacteria 2784
76 Ga0466708_436161 3300042652 Bacteria 8108
77 Ga0466727_236165 3300042655 Bacteria 1425
78 Ga0466696_323263 3300042596 Bacteria 5981
79 Ga0466716_186536 3300042605 Bacteria 4462
80 Ga0466719_287847 3300042606 Bacteria 1715
81 Ga0466719_412364 3300042606 Bacteria 15447
82 Ga0466720_026287 3300042607 Bacteria 2681
83 Ga0466720_079532 3300042607 Bacteria 3894
84 Ga0466711_084955 3300042615 Bacteria 2663
85 Ga0466715_177929 3300042616 Bacteria 8673
86 Ga0466715_210282 3300042616 Bacteria 4648
87 Ga0466723_279769 3300042618 Bacteria 1652
88 Ga0466705_072226 3300042612 Bacteria 2177
89 Ga0466732_132240 3300042656 Bacteria 1326
90 JGI24698J34947_10048340 3300002449 Bacteria 2155
91 JGI24700J35501_10930705 3300002508 Unclassified 19344
92 Ga0466703_369076 3300042636 Bacteria 2977
93 Ga0466708_446934 3300042652 Bacteria 2066
94 Ga0466691_045141 3300042593 Bacteria 21340
95 Ga0466691_113146 3300042593 Bacteria 4250
96 Ga0466719_186178 3300042606 Bacteria 5545
97 Ga0466720_073417 3300042607 Bacteria 1904
98 Ga0466720_133633 3300042607 Bacteria 6616
99 Ga0466722_181029 3300042609 Bacteria 2718
100 Ga0466705_524442 3300042612 Bacteria 2000
101 Ga0466715_626666 3300042616 Bacteria 1233
102 Ga0466718_000848 3300042617 Bacteria 1153
103 Ga0466723_035249 3300042618 Bacteria 15913
104 Ga0466732_031323 3300042656 Bacteria 1140
105 Ga0466729_249082 3300042621 Unclassified 4534
106 Ga0466703_041751 3300042636 Bacteria 8191
107 Ga0466703_146620 3300042636 Bacteria 1209
108 Ga0466704_119723 3300042643 Bacteria 1985
109 Ga0466709_223186 3300042648 Bacteria 1432
110 Ga0466708_055023 3300042652 Unclassified 9208
111 Ga0466708_097745 3300042652 Bacteria 3776
112 Ga0466727_048858 3300042655 Bacteria 3586
113 Ga0466691_224089 3300042593 Bacteria 5134
114 Ga0466696_092453 3300042596 Bacteria 7949
115 Ga0466696_156391 3300042596 Bacteria 7132
116 Ga0466696_438865 3300042596 Bacteria 2066
117 Ga0466716_240576 3300042605 Bacteria 1694
118 Ga0466716_409890 3300042605 Bacteria 1049
119 Ga0466716_499666 3300042605 Bacteria 11661
120 Ga0466720_168369 3300042607 Bacteria 2526
121 Ga0466722_265086 3300042609 Bacteria 4872
122 Ga0466711_019059 3300042615 Bacteria 12792
123 Ga0466711_216764 3300042615 Bacteria 3786
124 Ga0466715_053606 3300042616 Bacteria 33406
125 Ga0466715_413134 3300042616 Bacteria 19075
126 Ga0466715_637465 3300042616 Bacteria 7200
127 Ga0466726_492192 3300042619 Bacteria 1732
128 Ga0466728_484735 3300042620 Bacteria 6941
129 Ga0466703_126836 3300042636 Bacteria 4601
130 Ga0466704_014772 3300042643 Bacteria 6314
131 Ga0466704_220003 3300042643 Bacteria 52311
132 Ga0466704_258203 3300042643 Bacteria 4977
133 Ga0466709_378292 3300042648 Bacteria 18499
134 Ga0466708_167488 3300042652 Bacteria 4277
135 Ga0466727_130896 3300042655 Bacteria 4640
136 Ga0466727_337805 3300042655 Bacteria 3821
137 Ga0466690_110796 3300042590 Bacteria 3124
138 Ga0466693_196739 3300042592 Bacteria 1568
139 Ga0466691_112902 3300042593 Bacteria 2525
140 Ga0466696_021094 3300042596 Bacteria 9785
141 Ga0466696_394764 3300042596 Bacteria 1004
142 Ga0466719_460045 3300042606 Bacteria 4821
143 Ga0466722_035900 3300042609 Bacteria 7809
144 Ga0466722_099098 3300042609 Bacteria 2565
145 Ga0466712_156862 3300042614 Unclassified 1109
146 Ga0466718_102979 3300042617 Bacteria 3240
147 Ga0466723_326260 3300042618 Bacteria 2138
148 Ga0466726_057202 3300042619 Bacteria 1096

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_451464 Ga0466716_451464_10_573 187
2 3300042593 Ga0466691_045141 Ga0466691_045141_5338_5904 188
3 3300042619 Ga0466726_177337 Ga0466726_177337_442_1011 189
4 3300042607 Ga0466720_026287 Ga0466720_026287_21_593 190
5 3300042616 Ga0466715_210282 Ga0466715_210282_2275_2967 192
6 3300042636 Ga0466703_369076 Ga0466703_369076_1218_1802 194
7 3300042614 Ga0466712_212519 Ga0466712_212519_376_1056 199
8 3300042593 Ga0466691_047778 Ga0466691_047778_1047_1724 201
9 3300042612 Ga0466705_420383 Ga0466705_420383_930_1565 211
10 3300002449 JGI24698J34947_10048340 JGI24698J34947_100483402 214
11 3300042605 Ga0466716_413209 Ga0466716_413209_2821_3501 214
12 3300042612 Ga0466705_524442 Ga0466705_524442_914_1594 214
13 3300042617 Ga0466718_102979 Ga0466718_102979_1046_1729 214
14 3300042636 Ga0466703_133499 Ga0466703_133499_21487_22167 214
15 3300042655 Ga0466727_012637 Ga0466727_012637_1309_1989 217
16 3300042590 Ga0466690_259352 Ga0466690_259352_10_693 218
17 3300042593 Ga0466691_004554 Ga0466691_004554_15938_16618 218
18 3300042615 Ga0466711_216764 Ga0466711_216764_1101_1778 218
19 3300042616 Ga0466715_544846 Ga0466715_544846_758_1438 218
20 3300042648 Ga0466709_378292 Ga0466709_378292_6830_7486 218
21 3300042616 Ga0466715_029750 Ga0466715_029750_4201_4881 219
22 3300042620 Ga0466728_117892 Ga0466728_117892_8787_9467 219
23 3300042655 Ga0466727_130896 Ga0466727_130896_2459_3139 219
24 3300042655 Ga0466727_262817 Ga0466727_262817_789_1469 219
25 3300042656 Ga0466732_058009 Ga0466732_058009_1513_2199 219
26 3300042620 Ga0466728_001579 Ga0466728_001579_802_1482 220
27 3300042636 Ga0466703_163398 Ga0466703_163398_6145_6825 220
28 3300002508 JGI24700J35501_10930705 JGI24700J35501_1093070513 221
29 3300042656 Ga0466732_031323 Ga0466732_031323_248_934 221
30 3300042609 Ga0466722_035900 Ga0466722_035900_2629_3303 224
31 3300042624 Ga0466735_118849 Ga0466735_118849_334_1008 224
32 3300042592 Ga0466693_196739 Ga0466693_196739_601_1278 225
33 3300042619 Ga0466726_251339 Ga0466726_251339_387_1064 225
34 3300042636 Ga0466703_126836 Ga0466703_126836_2663_3340 225
35 3300042636 Ga0466703_146620 Ga0466703_146620_388_1065 225
36 3300042636 Ga0466703_289535 Ga0466703_289535_50_727 225
37 3300042643 Ga0466704_258203 Ga0466704_258203_720_1397 225
38 3300038395 Ga0415639_152145 Ga0415639_152145_413_1093 226
39 3300042590 Ga0466690_110796 Ga0466690_110796_1372_2052 226
40 3300042591 Ga0466692_019604 Ga0466692_019604_237_917 226
41 3300042591 Ga0466692_049820 Ga0466692_049820_3424_4104 226
42 3300042591 Ga0466692_198692 Ga0466692_198692_1291_1971 226
43 3300042593 Ga0466691_224089 Ga0466691_224089_545_1225 226
44 3300042596 Ga0466696_021094 Ga0466696_021094_3912_4592 226
45 3300042596 Ga0466696_092453 Ga0466696_092453_6418_7098 226
46 3300042596 Ga0466696_156391 Ga0466696_156391_195_875 226
47 3300042596 Ga0466696_201545 Ga0466696_201545_398_1078 226
48 3300042596 Ga0466696_323263 Ga0466696_323263_312_992 226
49 3300042605 Ga0466716_255008 Ga0466716_255008_6795_7475 226
50 3300042605 Ga0466716_255161 Ga0466716_255161_399_1079 226
51 3300042605 Ga0466716_409890 Ga0466716_409890_324_1004 226
52 3300042606 Ga0466719_186178 Ga0466719_186178_1257_1937 226
53 3300042606 Ga0466719_490569 Ga0466719_490569_3314_3994 226
54 3300042609 Ga0466722_077178 Ga0466722_077178_434_1114 226
55 3300042609 Ga0466722_099098 Ga0466722_099098_1373_2053 226
56 3300042609 Ga0466722_181029 Ga0466722_181029_531_1211 226
57 3300042609 Ga0466722_265086 Ga0466722_265086_3123_3803 226
58 3300042612 Ga0466705_072226 Ga0466705_072226_250_930 226
59 3300042612 Ga0466705_163351 Ga0466705_163351_4054_4734 226
60 3300042614 Ga0466712_156862 Ga0466712_156862_390_1070 226
61 3300042615 Ga0466711_019059 Ga0466711_019059_2788_3468 226
62 3300042615 Ga0466711_084955 Ga0466711_084955_1382_2062 226
63 3300042615 Ga0466711_194986 Ga0466711_194986_6071_6751 226
64 3300042615 Ga0466711_282742 Ga0466711_282742_431_1111 226
65 3300042615 Ga0466711_373543 Ga0466711_373543_1676_2356 226
66 3300042616 Ga0466715_413134 Ga0466715_413134_11318_11998 226
67 3300042616 Ga0466715_626666 Ga0466715_626666_342_1022 226
68 3300042618 Ga0466723_046496 Ga0466723_046496_3731_4411 226
69 3300042618 Ga0466723_156265 Ga0466723_156265_392_1072 226
70 3300042619 Ga0466726_057202 Ga0466726_057202_355_1035 226
71 3300042619 Ga0466726_250790 Ga0466726_250790_746_1426 226
72 3300042619 Ga0466726_492192 Ga0466726_492192_432_1112 226
73 3300042620 Ga0466728_484735 Ga0466728_484735_5514_6194 226
74 3300042621 Ga0466729_249082 Ga0466729_249082_1816_2496 226
75 3300042636 Ga0466703_041751 Ga0466703_041751_3024_3704 226
76 3300042636 Ga0466703_092275 Ga0466703_092275_4283_4963 226
77 3300042636 Ga0466703_109859 Ga0466703_109859_7773_8453 226
78 3300042636 Ga0466703_114006 Ga0466703_114006_2001_2681 226
79 3300042636 Ga0466703_367248 Ga0466703_367248_1271_1951 226
80 3300042636 Ga0466703_388582 Ga0466703_388582_5290_5970 226
81 3300042643 Ga0466704_014772 Ga0466704_014772_1207_1887 226
82 3300042643 Ga0466704_119723 Ga0466704_119723_950_1630 226
83 3300042643 Ga0466704_120416 Ga0466704_120416_12333_13013 226
84 3300042648 Ga0466709_124923 Ga0466709_124923_116_796 226
85 3300042648 Ga0466709_215233 Ga0466709_215233_606_1286 226
86 3300042648 Ga0466709_223186 Ga0466709_223186_194_874 226
87 3300042648 Ga0466709_354668 Ga0466709_354668_1625_2305 226
88 3300042652 Ga0466708_028939 Ga0466708_028939_179_859 226
89 3300042652 Ga0466708_055023 Ga0466708_055023_2225_2905 226
90 3300042652 Ga0466708_167488 Ga0466708_167488_259_939 226
91 3300042652 Ga0466708_353856 Ga0466708_353856_847_1527 226
92 3300042652 Ga0466708_436161 Ga0466708_436161_1514_2194 226
93 3300042652 Ga0466708_456632 Ga0466708_456632_481_1161 226
94 3300042655 Ga0466727_001812 Ga0466727_001812_541_1221 226
95 3300042655 Ga0466727_048858 Ga0466727_048858_1237_1917 226
96 3300042655 Ga0466727_067767 Ga0466727_067767_541_1221 226
97 3300042655 Ga0466727_236165 Ga0466727_236165_607_1287 226
98 3300042655 Ga0466727_255260 Ga0466727_255260_2626_3306 226
99 3300042655 Ga0466727_337805 Ga0466727_337805_969_1649 226
100 3300042656 Ga0466732_351593 Ga0466732_351593_460_1140 226
101 iso_pr_bacteria 2781125692 2781431333 226
102 iso_pr_bacteria 650716099 650877914 226
103 3300005201 Ga0072941_1031886 Ga0072941_10318863 227
104 3300005201 Ga0072941_1043532 Ga0072941_10435322 227
105 3300024493 Ga0264413_133271 Ga0264413_1332713 227
106 3300042596 Ga0466696_394764 Ga0466696_394764_199_882 227
107 3300042596 Ga0466696_438865 Ga0466696_438865_926_1609 227
108 3300042605 Ga0466716_186536 Ga0466716_186536_2984_3667 227
109 3300042605 Ga0466716_240576 Ga0466716_240576_439_1122 227
110 3300042606 Ga0466719_412364 Ga0466719_412364_3623_4306 227
111 3300042607 Ga0466720_063956 Ga0466720_063956_149_832 227
112 3300042607 Ga0466720_073417 Ga0466720_073417_576_1259 227
113 3300042607 Ga0466720_079532 Ga0466720_079532_2162_2845 227
114 3300042607 Ga0466720_133633 Ga0466720_133633_3305_3988 227
115 3300042607 Ga0466720_168369 Ga0466720_168369_1781_2464 227
116 3300042612 Ga0466705_039023 Ga0466705_039023_3781_4464 227
117 3300042612 Ga0466705_526326 Ga0466705_526326_995_1678 227
118 3300042616 Ga0466715_053606 Ga0466715_053606_26549_27232 227
119 3300042618 Ga0466723_326260 Ga0466723_326260_293_976 227
120 3300042643 Ga0466704_027263 Ga0466704_027263_949_1632 227
121 3300042643 Ga0466704_220003 Ga0466704_220003_48088_48771 227
122 3300042648 Ga0466709_196245 Ga0466709_196245_6585_7268 227
123 3300042652 Ga0466708_097745 Ga0466708_097745_616_1299 227
124 iso_pr_bacteria 2819994798 2819997140 227
125 3300000089 AustNasuHG_c1019004 AustNasuHG_10190042 228
126 3300042590 Ga0466690_203677 Ga0466690_203677_3475_4161 228
127 3300042606 Ga0466719_460045 Ga0466719_460045_3732_4418 228
128 3300042616 Ga0466715_637465 Ga0466715_637465_6090_6776 228
129 3300042618 Ga0466723_035249 Ga0466723_035249_14907_15593 228
130 3300042656 Ga0466732_132240 Ga0466732_132240_391_1077 228
131 3300042593 Ga0466691_112902 Ga0466691_112902_870_1559 229
132 3300042593 Ga0466691_113146 Ga0466691_113146_3429_4118 229
133 3300042596 Ga0466696_445148 Ga0466696_445148_11075_11764 229
134 3300042616 Ga0466715_177929 Ga0466715_177929_1500_2189 229
135 3300042618 Ga0466723_279769 Ga0466723_279769_578_1267 229
136 3300042624 Ga0466735_068981 Ga0466735_068981_331_1020 229
137 3300042643 Ga0466704_410758 Ga0466704_410758_237_926 229
138 3300042648 Ga0466709_207086 Ga0466709_207086_518_1207 229
139 3300042652 Ga0466708_446934 Ga0466708_446934_959_1648 229
140 3300042605 Ga0466716_499666 Ga0466716_499666_5351_6043 230
141 3300042616 Ga0466715_168491 Ga0466715_168491_6230_6922 230
142 3300042616 Ga0466715_291710 Ga0466715_291710_4909_5601 230
143 3300042643 Ga0466704_069242 Ga0466704_069242_4703_5395 230
144 3300042643 Ga0466704_417160 Ga0466704_417160_23651_24343 230
145 3300042652 Ga0466708_384397 Ga0466708_384397_6367_7059 230
146 3300042606 Ga0466719_287847 Ga0466719_287847_767_1462 231
147 3300042616 Ga0466715_299417 Ga0466715_299417_5772_6467 231
148 iso_pr_bacteria 2529293168 2531451622 231
149 3300042590 Ga0466690_150339 Ga0466690_150339_630_1328 232
150 3300042606 Ga0466719_004078 Ga0466719_004078_477_1187 236
151 3300042618 Ga0466723_216010 Ga0466723_216010_2032_2742 236
152 3300042617 Ga0466718_000848 Ga0466718_000848_357_1094 238

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04172 LrgB LrgB-like family 34 237 0.98

πŸ—οΈ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEndSuperfamily
af_Q2G134_11_311_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5495 30 236 1.20.1530.20
IDDescriptionScoreStartEndGO Terms
AF-A0A3N1ZQZ2-F1-model_v4 Uncharacterized/unreviewed 0.9433 19 233 GO:0016020
GO:0016787

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.