Protein Family IF07855

Metagenome Isolate
146 Members
52 Samples
138 Scaffolds
414.64 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_645924|Ga0466715_645924_6669_8174
Length
487 aa
Sequence
MNDIPAHGCFYAKIPFFSSFFVLFYFAARFFADIARFFAPPHAPRFHLTKALVHDILEMHAAPMGHVHYHRDKEFIVKKTMRALGIFLLLAAVFSPLYAGGGKQAVTLVMGSWRPDDTAQMNNLLAEYKKLKPNVTIQFRPTNPPDYNATLRLQLDGGTGPDLMYARSYAPGRELYNAGYFADCSGIGGVRQNFSAANLAPWQMPDGKMFAVPFAAVSHAVYYNKSIFKKEGLAIPATYEEFLALCETLAAKGYTPLANGVADEWDILEVFYLGMLPNFIGGGIERELYESGAKKLNDANFAASFKAMADAAKYLPKGFESVTYNDSQALFNTEQAVMFMDGSWTVSVYAGAPFEWGLFAMPAPAGRKTLITFHPDMAITYNKATKYPTECQEFLAWLASPAGAAVASKALPAGFFPMINAAITLDDPHANEFLALNSGKDTDARFVWPKFLDLYAPMNQAVIKVLKGEQTPQQAAGDMEAAAAKLR

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.2%
Kalotermitidae 27.5%
Unclassified 17.6%
Rhinotermitidae 5.9%
Termopsidae 5.9%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 139
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190975 Treponema sp. RmG30 Isolate Blaberidae
2 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
3 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
6 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
7 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
11 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
12 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
23 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
33 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
41 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
42 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
43 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
44 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
45 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
50 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
51 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_280272 3300042612 Bacteria 21056
2 Ga0466707_033985 3300042601 Bacteria 3104
3 Ga0466720_023132 3300042607 Bacteria 6990
4 Ga0466720_115208 3300042607 Bacteria 9027
5 Ga0466722_198990 3300042609 Bacteria 9170
6 JGI24702J35022_10017695 3300002462 Bacteria 3891
7 JGI24702J35022_10128948 3300002462 Bacteria 1403
8 Ga0068305_10061278 3300005083 Bacteria 11222
9 Ga0072941_1000156 3300005201 Bacteria 33336
10 Ga0123356_10001575 3300010049 Bacteria 25090
11 Ga0123356_10066084 3300010049 Bacteria 3385
12 Ga0123356_10279299 3300010049 Bacteria 1764
13 Ga0466703_045418 3300042636 Bacteria 2229
14 Ga0466709_067608 3300042648 Bacteria 24200
15 Ga0466715_540239 3300042616 Bacteria 1691
16 Ga0466723_031256 3300042618 Bacteria 5370
17 Ga0466726_002498 3300042619 Bacteria 7984
18 Ga0466728_375903 3300042620 Bacteria 11149
19 Ga0466693_152830 3300042592 Bacteria 52782
20 Ga0466699_413294 3300042597 Bacteria 25958
21 Ga0466732_036891 3300042656 Bacteria 25406
22 Ga0466722_031731 3300042609 Unclassified 2736
23 AustNasuHG_c1005232 3300000089 Bacteria 4637
24 JGI24698J34947_10004353 3300002449 Unclassified 7704
25 Ga0123356_10251595 3300010049 Bacteria 1845
26 Ga0466703_215039 3300042636 Bacteria 3746
27 Ga0466727_173603 3300042655 Bacteria 10717
28 Ga0466727_239367 3300042655 Bacteria 1761
29 Ga0466718_068515 3300042617 Bacteria 2631
30 Ga0466723_025944 3300042618 Bacteria 26067
31 Ga0466723_184160 3300042618 Bacteria 1566
32 Ga0456237_0001404 3300041968 Bacteria 3833
33 Ga0466705_058016 3300042612 Bacteria 2474
34 Ga0466716_102525 3300042605 Bacteria 18805
35 Ga0466716_176156 3300042605 Bacteria 3904
36 Ga0466722_095351 3300042609 Bacteria 10158
37 Ga0466722_125296 3300042609 Bacteria 8261
38 JGI24697J35500_11270226 3300002507 Unclassified 4171
39 Ga0123356_10013697 3300010049 Bacteria 7813
40 Ga0466704_095616 3300042643 Bacteria 8898
41 Ga0466704_354331 3300042643 Bacteria 2258
42 Ga0466709_051646 3300042648 Bacteria 6688
43 Ga0466708_218307 3300042652 Bacteria 2786
44 Ga0466718_055411 3300042617 Bacteria 18800
45 Ga0466723_078140 3300042618 Bacteria 6748
46 Ga0466726_042204 3300042619 Bacteria 3591
47 Ga0466726_087278 3300042619 Bacteria 3318
48 Ga0466728_006235 3300042620 Bacteria 3630
49 Ga0466728_097927 3300042620 Bacteria 3622
50 Ga0466690_050356 3300042590 Bacteria 26222
51 Ga0466690_357148 3300042590 Bacteria 13321
52 Ga0466691_100547 3300042593 Unclassified 4208
53 Ga0466732_356472 3300042656 Unclassified 1972
54 Ga0466719_221436 3300042606 Bacteria 5818
55 Ga0466720_144023 3300042607 Bacteria 21010
56 Ga0466722_008188 3300042609 Bacteria 6815
57 AustNasuHG_c1007557 3300000089 Bacteria 3859
58 JGI24695J34938_10000217 3300002450 Bacteria 55213
59 Ga0123353_10197656 3300010167 Bacteria 3168
60 Ga0466709_259288 3300042648 Bacteria 12163
61 Ga0466709_368115 3300042648 Bacteria 3806
62 Ga0466708_083956 3300042652 Bacteria 3525
63 Ga0466708_357048 3300042652 Bacteria 2127
64 Ga0466726_066536 3300042619 Bacteria 4893
65 Ga0415639_103570 3300038395 Bacteria 5260
66 Ga0415639_177906 3300038395 Bacteria 1825
67 Ga0466690_019877 3300042590 Bacteria 5459
68 Ga0466705_332881 3300042612 Bacteria 2362
69 Ga0466733_150287 3300042659 Bacteria 12115
70 Ga0466716_516700 3300042605 Bacteria 3518
71 Ga0466698_257566 3300042610 Unclassified 7917
72 JGI24698J34947_10002394 3300002449 Bacteria 10095
73 JGI24702J35022_10038221 3300002462 Bacteria 2563
74 Ga0123357_10214334 3300009784 Bacteria 2154
75 Ga0123356_10002032 3300010049 Bacteria 21840
76 Ga0466703_035869 3300042636 Bacteria 3683
77 Ga0466703_221289 3300042636 Bacteria 6508
78 Ga0466704_516777 3300042643 Bacteria 12748
79 Ga0466708_093297 3300042652 Bacteria 2880
80 Ga0466711_021704 3300042615 Bacteria 6171
81 Ga0466715_645924 3300042616 Bacteria 10578
82 Ga0466718_103405 3300042617 Bacteria 1250
83 Ga0466694_222263 3300042594 Bacteria 27991
84 Ga0466696_302117 3300042596 Bacteria 3206
85 Ga0466696_355841 3300042596 Bacteria 26852
86 Ga0466707_005042 3300042601 Bacteria 3543
87 Ga0466719_104197 3300042606 Bacteria 30611
88 JGI24702J35022_10004788 3300002462 Bacteria 7995
89 Ga0123353_10002040 3300010167 Bacteria 24948
90 Ga0123353_10318597 3300010167 Bacteria 2361
91 Ga0466735_231137 3300042624 Bacteria 1428
92 Ga0466703_065350 3300042636 Bacteria 3240
93 Ga0466703_326643 3300042636 Bacteria 4142
94 Ga0466709_232006 3300042648 Bacteria 6324
95 Ga0466709_260032 3300042648 Bacteria 1819
96 Ga0466708_165739 3300042652 Bacteria 3146
97 Ga0466727_107260 3300042655 Bacteria 1593
98 Ga0466718_133833 3300042617 Unclassified 3386
99 Ga0466723_046855 3300042618 Bacteria 5924
100 Ga0466723_057409 3300042618 Bacteria 7670
101 Ga0466723_151421 3300042618 Bacteria 5774
102 Ga0466723_369714 3300042618 Bacteria 4578
103 Ga0466657_274914 3300042582 Bacteria 1400
104 Ga0466690_159612 3300042590 Bacteria 15265
105 Ga0466692_047928 3300042591 Bacteria 29037
106 Ga0466692_125052 3300042591 Bacteria 28079
107 Ga0466694_112875 3300042594 Bacteria 3487
108 Ga0466699_021017 3300042597 Bacteria 4766
109 Ga0466699_072196 3300042597 Bacteria 50938
110 Ga0466714_092122 3300042603 Bacteria 2756
111 Ga0466722_100464 3300042609 Bacteria 1747
112 Ga0466735_111122 3300042624 Bacteria 4306
113 Ga0466709_123412 3300042648 Bacteria 9118
114 Ga0466723_107779 3300042618 Bacteria 6812
115 Ga0466726_280886 3300042619 Bacteria 9449
116 Ga0466696_112191 3300042596 Bacteria 3913
117 Ga0466696_174839 3300042596 Bacteria 2442
118 Ga0466696_190767 3300042596 Bacteria 10439
119 Ga0466733_032276 3300042659 Bacteria 21208
120 Ga0466714_102801 3300042603 Bacteria 1435
121 Ga0466719_091900 3300042606 Bacteria 3385
122 Ga0466722_008102 3300042609 Bacteria 6990
123 Ga0466722_066215 3300042609 Bacteria 4685
124 Ga0466722_183552 3300042609 Bacteria 3003
125 JGI24698J34947_10045207 3300002449 Bacteria 2249
126 JGI24702J35022_10092661 3300002462 Bacteria 1646
127 Ga0072941_1005035 3300005201 Bacteria 15346
128 Ga0466702_016929 3300042635 Bacteria 1783
129 Ga0466703_061593 3300042636 Bacteria 16078
130 Ga0466708_170931 3300042652 Bacteria 6957
131 Ga0466712_077031 3300042614 Bacteria 5736
132 Ga0466711_029879 3300042615 Bacteria 23647
133 Ga0466711_146877 3300042615 Bacteria 9604
134 Ga0466711_517498 3300042615 Bacteria 14845
135 Ga0466718_062430 3300042617 Bacteria 1647
136 Ga0466718_072158 3300042617 Bacteria 1925
137 Ga0466691_083023 3300042593 Bacteria 8661
138 Ga0466696_060405 3300042596 Bacteria 4531

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_103570 Ga0415639_103570_2772_4070 368
2 3300010049 Ga0123356_10251595 Ga0123356_102515952 385
3 3300042652 Ga0466708_165739 Ga0466708_165739_1669_2925 390
4 3300010049 Ga0123356_10002032 Ga0123356_100020324 396
5 3300042605 Ga0466716_176156 Ga0466716_176156_25_1215 396
6 3300042617 Ga0466718_055411 Ga0466718_055411_635_1873 399
7 3300042596 Ga0466696_355841 Ga0466696_355841_6172_7425 400
8 3300042616 Ga0466715_540239 Ga0466715_540239_468_1670 400
9 3300042617 Ga0466718_103405 Ga0466718_103405_17_1219 400
10 3300042617 Ga0466718_133833 Ga0466718_133833_1625_2827 400
11 3300042603 Ga0466714_092122 Ga0466714_092122_286_1542 402
12 3300042656 Ga0466732_356472 Ga0466732_356472_545_1756 403
13 3300042582 Ga0466657_274914 Ga0466657_274914_70_1347 404
14 3300042601 Ga0466707_033985 Ga0466707_033985_258_1472 404
15 3300042607 Ga0466720_115208 Ga0466720_115208_5702_6919 405
16 3300042609 Ga0466722_008102 Ga0466722_008102_1534_2751 405
17 3300042615 Ga0466711_029879 Ga0466711_029879_21773_22990 405
18 3300042617 Ga0466718_062430 Ga0466718_062430_240_1478 405
19 3300000089 AustNasuHG_c1007557 AustNasuHG_10075572 406
20 3300010049 Ga0123356_10001575 Ga0123356_100015755 406
21 3300042597 Ga0466699_413294 Ga0466699_413294_21887_23134 406
22 3300042655 Ga0466727_107260 Ga0466727_107260_16_1236 406
23 iso_pr_bacteria 2820405014 2820406218 406
24 3300042591 Ga0466692_125052 Ga0466692_125052_18818_20065 407
25 3300042643 Ga0466704_095616 Ga0466704_095616_6607_7872 407
26 3300010167 Ga0123353_10197656 Ga0123353_101976562 408
27 3300042605 Ga0466716_102525 Ga0466716_102525_7800_9032 410
28 3300042636 Ga0466703_221289 Ga0466703_221289_3890_5152 410
29 3300042659 Ga0466733_032276 Ga0466733_032276_285_1517 410
30 3300002449 JGI24698J34947_10004353 JGI24698J34947_100043538 411
31 3300002507 JGI24697J35500_11270226 JGI24697J35500_112702265 411
32 3300042603 Ga0466714_102801 Ga0466714_102801_12_1247 411
33 3300042614 Ga0466712_077031 Ga0466712_077031_818_2053 411
34 3300042618 Ga0466723_369714 Ga0466723_369714_3239_4492 411
35 iso_pr_bacteria 2781125691 2781428936 411
36 3300000089 AustNasuHG_c1005232 AustNasuHG_10052325 412
37 3300002449 JGI24698J34947_10045207 JGI24698J34947_100452072 412
38 3300005201 Ga0072941_1000156 Ga0072941_100015618 412
39 3300005201 Ga0072941_1005035 Ga0072941_100503511 412
40 3300038395 Ga0415639_177906 Ga0415639_177906_548_1807 412
41 3300042615 Ga0466711_021704 Ga0466711_021704_2508_3746 412
42 3300042617 Ga0466718_068515 Ga0466718_068515_133_1371 412
43 3300042648 Ga0466709_123412 Ga0466709_123412_4911_6149 412
44 iso_pr_bacteria 2772190975 2773723967 412
45 3300002450 JGI24695J34938_10000217 JGI24695J34938_1000021712 413
46 3300002462 JGI24702J35022_10128948 JGI24702J35022_101289481 413
47 3300042590 Ga0466690_159612 Ga0466690_159612_2409_3650 413
48 3300042597 Ga0466699_021017 Ga0466699_021017_2109_3350 413
49 3300042609 Ga0466722_066215 Ga0466722_066215_2841_4082 413
50 3300042618 Ga0466723_184160 Ga0466723_184160_151_1392 413
51 3300042636 Ga0466703_061593 Ga0466703_061593_14386_15627 413
52 3300042655 Ga0466727_239367 Ga0466727_239367_314_1555 413
53 3300042656 Ga0466732_036891 Ga0466732_036891_5317_6558 413
54 iso_pr_bacteria 2781125634 2781273764 413
55 3300002449 JGI24698J34947_10002394 JGI24698J34947_100023945 414
56 3300042590 Ga0466690_050356 Ga0466690_050356_12707_13951 414
57 3300042591 Ga0466692_047928 Ga0466692_047928_25011_26255 414
58 3300042594 Ga0466694_112875 Ga0466694_112875_269_1513 414
59 3300042596 Ga0466696_302117 Ga0466696_302117_874_2118 414
60 3300042601 Ga0466707_005042 Ga0466707_005042_2126_3370 414
61 3300042609 Ga0466722_100464 Ga0466722_100464_313_1557 414
62 3300042610 Ga0466698_257566 Ga0466698_257566_2913_4157 414
63 3300042636 Ga0466703_326643 Ga0466703_326643_2494_3738 414
64 3300042659 Ga0466733_150287 Ga0466733_150287_2300_3544 414
65 iso_pr_bacteria 2781125661 2781333612 414
66 3300010049 Ga0123356_10013697 Ga0123356_100136974 415
67 3300010049 Ga0123356_10279299 Ga0123356_102792992 415
68 3300042592 Ga0466693_152830 Ga0466693_152830_31608_32855 415
69 3300042594 Ga0466694_222263 Ga0466694_222263_11558_12805 415
70 3300042597 Ga0466699_072196 Ga0466699_072196_40670_41917 415
71 3300042607 Ga0466720_144023 Ga0466720_144023_12315_13562 415
72 3300042609 Ga0466722_008188 Ga0466722_008188_434_1681 415
73 3300042609 Ga0466722_183552 Ga0466722_183552_1146_2393 415
74 3300042609 Ga0466722_198990 Ga0466722_198990_7772_9019 415
75 3300042624 Ga0466735_111122 Ga0466735_111122_1361_2608 415
76 3300042652 Ga0466708_083956 Ga0466708_083956_327_1574 415
77 3300042652 Ga0466708_170931 Ga0466708_170931_3315_4562 415
78 iso_pr_bacteria 2781125692 2781430753 415
79 3300002462 JGI24702J35022_10017695 JGI24702J35022_100176952 416
80 3300005083 Ga0068305_10061278 Ga0068305_100612782 416
81 3300042593 Ga0466691_083023 Ga0466691_083023_6860_8110 416
82 3300042593 Ga0466691_100547 Ga0466691_100547_2756_4006 416
83 3300042596 Ga0466696_060405 Ga0466696_060405_689_1939 416
84 3300042606 Ga0466719_221436 Ga0466719_221436_2640_3890 416
85 3300042615 Ga0466711_146877 Ga0466711_146877_3404_4654 416
86 3300042617 Ga0466718_072158 Ga0466718_072158_168_1418 416
87 3300042618 Ga0466723_031256 Ga0466723_031256_3636_4886 416
88 3300042618 Ga0466723_046855 Ga0466723_046855_4106_5356 416
89 3300042618 Ga0466723_107779 Ga0466723_107779_211_1461 416
90 3300042619 Ga0466726_002498 Ga0466726_002498_1605_2855 416
91 3300042619 Ga0466726_066536 Ga0466726_066536_130_1380 416
92 3300042620 Ga0466728_006235 Ga0466728_006235_473_1723 416
93 3300042624 Ga0466735_231137 Ga0466735_231137_73_1323 416
94 3300042648 Ga0466709_067608 Ga0466709_067608_4941_6191 416
95 3300042652 Ga0466708_357048 Ga0466708_357048_680_1930 416
96 iso_pr_bacteria 2781125696 2781442044 416
97 3300002462 JGI24702J35022_10004788 JGI24702J35022_100047885 417
98 3300002462 JGI24702J35022_10038221 JGI24702J35022_100382213 417
99 3300002462 JGI24702J35022_10092661 JGI24702J35022_100926612 417
100 3300010167 Ga0123353_10002040 Ga0123353_100020404 417
101 3300010167 Ga0123353_10318597 Ga0123353_103185972 417
102 3300042606 Ga0466719_104197 Ga0466719_104197_29216_30469 417
103 3300042615 Ga0466711_517498 Ga0466711_517498_6914_8167 417
104 3300042618 Ga0466723_151421 Ga0466723_151421_1930_3183 417
105 3300042619 Ga0466726_087278 Ga0466726_087278_137_1390 417
106 3300042619 Ga0466726_280886 Ga0466726_280886_7584_8837 417
107 3300042636 Ga0466703_035869 Ga0466703_035869_1038_2291 417
108 3300042636 Ga0466703_045418 Ga0466703_045418_470_1723 417
109 3300042636 Ga0466703_215039 Ga0466703_215039_1850_3103 417
110 3300042643 Ga0466704_354331 Ga0466704_354331_272_1525 417
111 3300042652 Ga0466708_218307 Ga0466708_218307_666_1919 417
112 3300042655 Ga0466727_173603 Ga0466727_173603_5948_7201 417
113 3300010049 Ga0123356_10066084 Ga0123356_100660842 418
114 3300042609 Ga0466722_031731 Ga0466722_031731_310_1566 418
115 3300042609 Ga0466722_095351 Ga0466722_095351_7375_8631 418
116 3300042609 Ga0466722_125296 Ga0466722_125296_3292_4548 418
117 3300042636 Ga0466703_065350 Ga0466703_065350_502_1758 418
118 3300042648 Ga0466709_259288 Ga0466709_259288_209_1465 418
119 3300042648 Ga0466709_260032 Ga0466709_260032_436_1692 418
120 3300042648 Ga0466709_368115 Ga0466709_368115_2250_3506 418
121 3300042652 Ga0466708_093297 Ga0466708_093297_686_1942 418
122 3300042590 Ga0466690_019877 Ga0466690_019877_454_1713 419
123 3300042596 Ga0466696_174839 Ga0466696_174839_730_1989 419
124 3300042596 Ga0466696_190767 Ga0466696_190767_8324_9583 419
125 3300042606 Ga0466719_091900 Ga0466719_091900_1875_3134 419
126 3300042607 Ga0466720_023132 Ga0466720_023132_1949_3208 419
127 3300042612 Ga0466705_332881 Ga0466705_332881_560_1843 419
128 3300042618 Ga0466723_025944 Ga0466723_025944_19942_21201 419
129 3300042612 Ga0466705_280272 Ga0466705_280272_11074_12336 420
130 3300042643 Ga0466704_516777 Ga0466704_516777_5113_6375 420
131 3300042648 Ga0466709_232006 Ga0466709_232006_253_1515 420
132 3300042596 Ga0466696_112191 Ga0466696_112191_2275_3540 421
133 3300042618 Ga0466723_078140 Ga0466723_078140_810_2078 422
134 3300042619 Ga0466726_042204 Ga0466726_042204_1642_2910 422
135 3300042635 Ga0466702_016929 Ga0466702_016929_162_1430 422
136 3300041968 Ga0456237_0001404 Ga0456237_0001404_2409_3683 424
137 3300009784 Ga0123357_10214334 Ga0123357_102143342 429
138 3300042620 Ga0466728_097927 Ga0466728_097927_76_1371 431
139 3300042590 Ga0466690_357148 Ga0466690_357148_8499_9797 432
140 3300042605 Ga0466716_516700 Ga0466716_516700_143_1444 433
141 3300042618 Ga0466723_057409 Ga0466723_057409_6199_7500 433
142 3300042648 Ga0466709_051646 Ga0466709_051646_2135_3448 437
143 3300042612 Ga0466705_058016 Ga0466705_058016_870_2189 439
144 3300042620 Ga0466728_375903 Ga0466728_375903_7591_8913 440
145 iso_pr_bacteria 2820464928 2820465376 449
146 3300042616 Ga0466715_645924 Ga0466715_645924_6669_8174 487

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein 118 404 0.82
PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein 124 429 0.76

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.