Protein Family IF07850
Metagenome
Isolate
343
Members
197
Samples
201
Scaffolds
307.2
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_631008|Ga0466715_631008_85_1212
- Length
- 375 aa
- Sequence
- MLRLVCGLRLAKKNRAAAAKLLDKRLGMSDNRCIKWRGKSLGLLQALMPLQECARDKRQKRKRELMVELKSVCKSFGSVQALKNISISAGSGRAYGLLGRNGAGKTTTLRIIMDIFKPDRGTVLIDGKPAGKSNARIGYLPEERGLYPRRLVGEQMVYIGVLRGLSKETAQRNAKRLLKELEVPEYYQRKLETLSKGNQQKIQLAVALISEPDLLILDEPFSGLDPVNAKILKDIVKKQSAEGKTILFSSHQMSQVEEFCEEICIINKGEKVLEGRIDDIKRSYPRNIYYVSVGGFAADEFLTAVMRQMGSWCKGIRRKGPGFEVALVEPSARGMLFDAIRQQGLTPEVFTVKEPTLEEIFVEKAGGSDETGEEN
Sample Types
Isolate
41.4%
Metagenome
58.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
25.6%
Termitidae
16.1%
Drosophilidae
12.2%
Apidae
9.4%
Kalotermitidae
5.6%
Halictidae
5.0%
Pyralidae
3.3%
Tenebrionidae
3.3%
Rhinotermitidae
2.8%
Scarabaeidae
2.8%
Bombycidae
1.7%
Termopsidae
1.7%
Formicidae
1.7%
Elmidae
1.1%
Blattidae
1.1%
Passalidae
1.1%
Libellulidae
0.6%
Hydrophilidae
0.6%
Noctuidae
0.6%
Eresidae
0.6%
Culicidae
0.6%
Dytiscidae
0.6%
Gomphidae
0.6%
Ocypodidae
0.6%
Vespidae
0.6%
Portunidae
0.6%
Taxonomy
Archaea
0
Bacteria
323
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 2 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 3 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 4 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 5 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 10 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 11 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 12 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 13 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 14 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 15 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 16 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 17 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 21 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 22 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 23 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 24 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 25 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 26 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 27 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 28 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 29 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 30 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 31 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 32 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 33 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 34 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 35 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 36 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 37 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 38 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 39 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 40 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 41 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 42 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 43 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 49 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 50 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 51 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 52 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 53 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 54 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 55 | 2820734335 | Unclassified Chloroflexi Lab288P3bin99 | Isolate | Unclassified |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 59 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 60 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 61 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 62 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 63 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 64 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 65 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 66 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 67 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 68 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 69 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 70 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 71 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 72 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 73 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 74 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 75 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 76 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 77 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 78 | 2820733257 | Unclassified Chloroflexi Lab288P4bin59 | Isolate | Unclassified |
| 79 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 80 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 81 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 82 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 83 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 84 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 85 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 86 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 87 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 88 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 89 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 90 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 91 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 92 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 93 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 94 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 95 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 96 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 97 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 98 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 99 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 100 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 101 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 102 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 103 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 104 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 105 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 106 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 107 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 108 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 109 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 110 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 111 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 112 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 113 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 114 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 115 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 116 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 117 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 118 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 119 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 120 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 121 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 122 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 123 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 124 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 125 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 126 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 127 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 128 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 129 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 130 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 131 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 132 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 133 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 134 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 135 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 136 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 137 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 138 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 139 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 140 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 141 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 142 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 143 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 144 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 145 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 146 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 147 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 148 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 149 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 150 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 151 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 152 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 153 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 154 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 155 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 156 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 157 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 158 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 159 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 160 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 161 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 162 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 163 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 164 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 165 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 166 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 167 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 168 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 169 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 170 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 171 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 172 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 173 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 174 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 175 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 176 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 177 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 178 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 179 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 180 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 181 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 182 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 183 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 184 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 185 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 186 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 187 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 188 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 189 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 190 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 191 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 192 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 193 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 194 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 195 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 196 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 197 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0530661_042219 | 3300056564 | Bacteria | 1326 |
| 2 | Ga0562379_0035 | 3300056790 | Bacteria | 679259 |
| 3 | Ga0562379_0073 | 3300056790 | Bacteria | 410385 |
| 4 | Ga0562379_0745 | 3300056790 | Bacteria | 54476 |
| 5 | Ga0562375_0005 | 3300056856 | Bacteria | 2472444 |
| 6 | 2227494095 | 2225789004 | Bacteria | 3997 |
| 7 | JGI24698J34947_10000892 | 3300002449 | Bacteria | 15123 |
| 8 | JGI24698J34947_10052395 | 3300002449 | Unclassified | 2048 |
| 9 | JGI24702J35022_10100723 | 3300002462 | Bacteria | 1581 |
| 10 | JGI24702J35022_10126241 | 3300002462 | Bacteria | 1417 |
| 11 | JGI24700J35501_10849990 | 3300002508 | Bacteria | 1966 |
| 12 | Ga0466735_013597 | 3300042624 | Bacteria | 199947 |
| 13 | Ga0466703_038561 | 3300042636 | Bacteria | 1325 |
| 14 | Ga0466703_117476 | 3300042636 | Bacteria | 29454 |
| 15 | Ga0466718_020487 | 3300042617 | Bacteria | 1285 |
| 16 | Ga0456237_0003896 | 3300041968 | Bacteria | 2406 |
| 17 | Ga0123355_10098550 | 3300009826 | Bacteria | 4610 |
| 18 | Ga0123356_10016974 | 3300010049 | Bacteria | 6934 |
| 19 | Ga0123353_10160117 | 3300010167 | Bacteria | 3585 |
| 20 | Ga0466707_065903 | 3300042601 | Bacteria | 3814 |
| 21 | Ga0466707_120204 | 3300042601 | Bacteria | 23436 |
| 22 | Ga0466697_145326 | 3300042611 | Bacteria | 3536 |
| 23 | Ga0562375_0100 | 3300056856 | Bacteria | 265693 |
| 24 | Ga0562374_1386 | 3300057007 | Unclassified | 28696 |
| 25 | JGI24698J34947_10012730 | 3300002449 | Bacteria | 4606 |
| 26 | JGI24703J35330_11747588 | 3300002501 | Bacteria | 7396 |
| 27 | JGI24697J35500_11273298 | 3300002507 | Bacteria | 5525 |
| 28 | Ga0466729_316237 | 3300042621 | Bacteria | 22092 |
| 29 | Ga0466734_006750 | 3300042623 | Bacteria | 5095 |
| 30 | Ga0466704_004753 | 3300042643 | Bacteria | 14844 |
| 31 | Ga0466708_114903 | 3300042652 | Bacteria | 49445 |
| 32 | Ga0466715_226389 | 3300042616 | Bacteria | 29197 |
| 33 | Ga0466728_178759 | 3300042620 | Bacteria | 5871 |
| 34 | Ga0466692_131728 | 3300042591 | Bacteria | 45931 |
| 35 | Ga0466696_286602 | 3300042596 | Bacteria | 3571 |
| 36 | Ga0123357_10090522 | 3300009784 | Unclassified | 3990 |
| 37 | Ga0123355_10000621 | 3300009826 | Bacteria | 47975 |
| 38 | Ga0123355_10014213 | 3300009826 | Unclassified | 12435 |
| 39 | Ga0123355_10031758 | 3300009826 | Unclassified | 8568 |
| 40 | Ga0123353_10033378 | 3300010167 | Bacteria | 8014 |
| 41 | Ga0123353_10134245 | 3300010167 | Unclassified | 3970 |
| 42 | Ga0123353_10444674 | 3300010167 | Bacteria | 1911 |
| 43 | Ga0123353_10447995 | 3300010167 | Bacteria | 1902 |
| 44 | Ga0466707_318547 | 3300042601 | Bacteria | 2727 |
| 45 | Ga0466713_135694 | 3300042602 | Bacteria | 11679 |
| 46 | Ga0466717_055277 | 3300042604 | Bacteria | 1140 |
| 47 | Ga0466722_017663 | 3300042609 | Bacteria | 3937 |
| 48 | Ga0466722_060541 | 3300042609 | Bacteria | 3019 |
| 49 | Ga0466697_192943 | 3300042611 | Bacteria | 2560 |
| 50 | Ga0562374_0568 | 3300057007 | Bacteria | 59172 |
| 51 | IMNBL1DRAFT_c0010389 | 3300000062 | Bacteria | 4464 |
| 52 | JGI24703J35330_11732838 | 3300002501 | Bacteria | 2815 |
| 53 | JGI24703J35330_11745445 | 3300002501 | Bacteria | 4593 |
| 54 | Ga0466727_265395 | 3300042655 | Bacteria | 1395 |
| 55 | Ga0466712_221181 | 3300042614 | Bacteria | 28077 |
| 56 | Ga0466723_091070 | 3300042618 | Bacteria | 80773 |
| 57 | Ga0415639_043799 | 3300038395 | Bacteria | 8558 |
| 58 | Ga0466692_046574 | 3300042591 | Bacteria | 14818 |
| 59 | Ga0466692_191207 | 3300042591 | Unclassified | 7719 |
| 60 | Ga0466696_233238 | 3300042596 | Bacteria | 1556 |
| 61 | Ga0123356_10012351 | 3300010049 | Bacteria | 8292 |
| 62 | Ga0123356_10511735 | 3300010049 | Bacteria | 1358 |
| 63 | Ga0123353_10165298 | 3300010167 | Unclassified | 3518 |
| 64 | Ga0123353_10201478 | 3300010167 | Bacteria | 3131 |
| 65 | Ga0466707_052901 | 3300042601 | Bacteria | 24964 |
| 66 | Ga0466707_233622 | 3300042601 | Bacteria | 11636 |
| 67 | Ga0466707_243590 | 3300042601 | Bacteria | 5607 |
| 68 | Ga0466713_059769 | 3300042602 | Bacteria | 172763 |
| 69 | Ga0562379_0864 | 3300056790 | Bacteria | 45677 |
| 70 | Ga0562377_0264 | 3300056842 | Bacteria | 116515 |
| 71 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 72 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 73 | Ga0072940_1099348 | 3300005200 | Bacteria | 7185 |
| 74 | Ga0466724_56909 | 3300042649 | Bacteria | 15742 |
| 75 | Ga0466712_101966 | 3300042614 | Bacteria | 2957 |
| 76 | Ga0466726_252095 | 3300042619 | Bacteria | 6933 |
| 77 | Ga0466728_001147 | 3300042620 | Bacteria | 2698 |
| 78 | Ga0466696_312354 | 3300042596 | Bacteria | 4120 |
| 79 | Ga0123357_10035602 | 3300009784 | Bacteria | 6768 |
| 80 | Ga0123353_10129141 | 3300010167 | Bacteria | 4058 |
| 81 | Ga0123353_10926471 | 3300010167 | Bacteria | 1182 |
| 82 | Ga0123354_10143987 | 3300010882 | Bacteria | 2929 |
| 83 | Ga0466707_344657 | 3300042601 | Bacteria | 6400 |
| 84 | Ga0466713_026803 | 3300042602 | Bacteria | 64874 |
| 85 | Ga0466719_045714 | 3300042606 | Bacteria | 2612 |
| 86 | Ga0466719_456299 | 3300042606 | Bacteria | 2333 |
| 87 | Ga0466722_246602 | 3300042609 | Bacteria | 12685 |
| 88 | Ga0562377_0882 | 3300056842 | Unclassified | 39194 |
| 89 | JGI24698J34947_10000311 | 3300002449 | Bacteria | 21367 |
| 90 | JGI24698J34947_10005559 | 3300002449 | Unclassified | 6915 |
| 91 | JGI24698J34947_10011833 | 3300002449 | Unclassified | 4792 |
| 92 | JGI24698J34947_10034459 | 3300002449 | Bacteria | 2649 |
| 93 | JGI24700J35501_10930816 | 3300002508 | Bacteria | 25448 |
| 94 | JGI24700J35501_10930817 | 3300002508 | Bacteria | 25486 |
| 95 | CVPL010L_1001570 | 3300002932 | Bacteria | 3609 |
| 96 | Ga0072941_1002644 | 3300005201 | Bacteria | 83076 |
| 97 | Ga0466734_160894 | 3300042623 | Bacteria | 1334 |
| 98 | Ga0466734_165511 | 3300042623 | Bacteria | 1189 |
| 99 | Ga0466730_024608 | 3300042625 | Unclassified | 6883 |
| 100 | Ga0466711_406868 | 3300042615 | Bacteria | 4072 |
| 101 | Ga0466715_146475 | 3300042616 | Bacteria | 8599 |
| 102 | Ga0466715_418785 | 3300042616 | Bacteria | 3278 |
| 103 | Ga0466726_037128 | 3300042619 | Bacteria | 7242 |
| 104 | Ga0415639_002705 | 3300038395 | Bacteria | 45823 |
| 105 | Ga0415639_185778 | 3300038395 | Bacteria | 2901 |
| 106 | Ga0466694_205019 | 3300042594 | Bacteria | 3232 |
| 107 | Ga0123357_10153687 | 3300009784 | Bacteria | 2783 |
| 108 | Ga0123355_10004025 | 3300009826 | Bacteria | 21295 |
| 109 | Ga0123355_10088251 | 3300009826 | Bacteria | 4927 |
| 110 | Ga0123356_10047255 | 3300010049 | Bacteria | 4004 |
| 111 | Ga0123356_10122078 | 3300010049 | Bacteria | 2536 |
| 112 | Ga0123356_10154554 | 3300010049 | Bacteria | 2283 |
| 113 | Ga0123353_10005780 | 3300010167 | Bacteria | 16326 |
| 114 | Ga0123353_10086059 | 3300010167 | Bacteria | 5062 |
| 115 | Ga0123353_10121090 | 3300010167 | Bacteria | 4208 |
| 116 | Ga0123354_10023525 | 3300010882 | Bacteria | 9714 |
| 117 | Ga0123354_10046303 | 3300010882 | Bacteria | 6646 |
| 118 | Ga0123354_10118954 | 3300010882 | Bacteria | 3426 |
| 119 | Ga0123354_10129766 | 3300010882 | Bacteria | 3191 |
| 120 | Ga0466700_414066 | 3300042600 | Bacteria | 3209 |
| 121 | Ga0466707_106253 | 3300042601 | Bacteria | 108878 |
| 122 | Ga0466707_172858 | 3300042601 | Bacteria | 9195 |
| 123 | Ga0466707_233573 | 3300042601 | Unclassified | 2266 |
| 124 | Ga0466733_062564 | 3300042659 | Bacteria | 17813 |
| 125 | Ga0466733_120672 | 3300042659 | Bacteria | 26705 |
| 126 | Ga0562377_0019 | 3300056842 | Bacteria | 1067000 |
| 127 | JGI24696J40584_12959644 | 3300002834 | Bacteria | 5412 |
| 128 | Ga0072941_1059063 | 3300005201 | Bacteria | 39555 |
| 129 | Ga0466735_192787 | 3300042624 | Bacteria | 4212 |
| 130 | Ga0466703_266629 | 3300042636 | Bacteria | 2184 |
| 131 | Ga0466704_128930 | 3300042643 | Bacteria | 11229 |
| 132 | Ga0466704_504111 | 3300042643 | Bacteria | 7744 |
| 133 | Ga0466708_295249 | 3300042652 | Bacteria | 14129 |
| 134 | Ga0466712_009968 | 3300042614 | Bacteria | 14444 |
| 135 | Ga0466712_113890 | 3300042614 | Bacteria | 23988 |
| 136 | Ga0466726_052608 | 3300042619 | Bacteria | 4820 |
| 137 | Ga0466693_194138 | 3300042592 | Bacteria | 3782 |
| 138 | Ga0466696_010017 | 3300042596 | Bacteria | 6157 |
| 139 | Ga0123355_10045932 | 3300009826 | Unclassified | 7104 |
| 140 | Ga0123355_10138664 | 3300009826 | Bacteria | 3729 |
| 141 | Ga0123356_10013031 | 3300010049 | Bacteria | 8043 |
| 142 | Ga0123354_10177455 | 3300010882 | Bacteria | 2448 |
| 143 | Ga0466707_011603 | 3300042601 | Bacteria | 2904 |
| 144 | Ga0466707_154618 | 3300042601 | Bacteria | 8330 |
| 145 | Ga0466697_280414 | 3300042611 | Bacteria | 4429 |
| 146 | Ga0466733_101104 | 3300042659 | Bacteria | 1324 |
| 147 | Ga0530661_000258 | 3300056564 | Bacteria | 42354 |
| 148 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 149 | Ga0562379_0363 | 3300056790 | Bacteria | 104557 |
| 150 | Ga0562377_0063 | 3300056842 | Bacteria | 461046 |
| 151 | Ga0562375_0009 | 3300056856 | Bacteria | 1746158 |
| 152 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 153 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 154 | JGI24695J34938_10069575 | 3300002450 | Unclassified | 1475 |
| 155 | JGI24703J35330_11746237 | 3300002501 | Bacteria | 5088 |
| 156 | Ga0105553_1088541 | 3300007767 | Unclassified | 3007 |
| 157 | Ga0466734_019526 | 3300042623 | Bacteria | 2273 |
| 158 | Ga0466727_045726 | 3300042655 | Bacteria | 10597 |
| 159 | Ga0466715_067285 | 3300042616 | Bacteria | 27295 |
| 160 | Ga0466715_547364 | 3300042616 | Bacteria | 11495 |
| 161 | Ga0466715_631008 | 3300042616 | Bacteria | 2889 |
| 162 | Ga0466726_485267 | 3300042619 | Bacteria | 1522 |
| 163 | Ga0415639_208694 | 3300038395 | Bacteria | 3844 |
| 164 | Ga0466656_324624 | 3300042550 | Bacteria | 1013 |
| 165 | Ga0466696_114898 | 3300042596 | Bacteria | 1488 |
| 166 | Ga0123355_10038641 | 3300009826 | Bacteria | 7763 |
| 167 | Ga0123355_10395654 | 3300009826 | Bacteria | 1787 |
| 168 | Ga0123356_10016162 | 3300010049 | Bacteria | 7128 |
| 169 | Ga0123356_10018538 | 3300010049 | Unclassified | 6605 |
| 170 | Ga0123353_10074706 | 3300010167 | Bacteria | 5448 |
| 171 | Ga0123353_10804060 | 3300010167 | Bacteria | 1298 |
| 172 | Ga0123353_10959585 | 3300010167 | Bacteria | 1155 |
| 173 | Ga0466701_051645 | 3300042598 | Bacteria | 1644 |
| 174 | Ga0466707_224672 | 3300042601 | Bacteria | 2261 |
| 175 | Ga0466722_086033 | 3300042609 | Bacteria | 2197 |
| 176 | Ga0466705_197008 | 3300042612 | Bacteria | 18545 |
| 177 | Ga0466705_364507 | 3300042612 | Bacteria | 1423 |
| 178 | Ga0562379_0231 | 3300056790 | Bacteria | 152000 |
| 179 | 2227090010 | 2225789004 | Bacteria | 1839 |
| 180 | 2227150830 | 2225789004 | Bacteria | 1588 |
| 181 | JGI24698J34947_10000844 | 3300002449 | Bacteria | 15391 |
| 182 | Ga0466734_161874 | 3300042623 | Bacteria | 2573 |
| 183 | Ga0466712_072724 | 3300042614 | Unclassified | 6369 |
| 184 | Ga0466715_097016 | 3300042616 | Bacteria | 22103 |
| 185 | Ga0466694_222635 | 3300042594 | Unclassified | 1701 |
| 186 | Ga0466696_365644 | 3300042596 | Bacteria | 2105 |
| 187 | Ga0123357_10015989 | 3300009784 | Bacteria | 9857 |
| 188 | Ga0123357_10031484 | 3300009784 | Unclassified | 7196 |
| 189 | Ga0123355_10039985 | 3300009826 | Bacteria | 7633 |
| 190 | Ga0123355_10080377 | 3300009826 | Bacteria | 5205 |
| 191 | Ga0123356_10039591 | 3300010049 | Bacteria | 4391 |
| 192 | Ga0123353_10305520 | 3300010167 | Bacteria | 2425 |
| 193 | Ga0123353_10307384 | 3300010167 | Bacteria | 2416 |
| 194 | Ga0123353_10915876 | 3300010167 | Bacteria | 1191 |
| 195 | Ga0123354_10280901 | 3300010882 | Bacteria | 1617 |
| 196 | Ga0466700_125904 | 3300042600 | Bacteria | 18922 |
| 197 | Ga0466707_083766 | 3300042601 | Bacteria | 14435 |
| 198 | Ga0466707_181727 | 3300042601 | Bacteria | 103366 |
| 199 | Ga0466707_359476 | 3300042601 | Bacteria | 5626 |
| 200 | Ga0466714_064292 | 3300042603 | Bacteria | 74164 |
| 201 | Ga0466719_155889 | 3300042606 | Bacteria | 6002 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300009784 | Ga0123357_10031484 | Ga0123357_100314845 | 263 |
| 2 | 3300042612 | Ga0466705_364507 | Ga0466705_364507_601_1410 | 269 |
| 3 | iso_pr_bacteria | 2820357977 | 2820359998 | 281 |
| 4 | 3300042550 | Ga0466656_324624 | Ga0466656_324624_144_998 | 284 |
| 5 | 3300042618 | Ga0466723_091070 | Ga0466723_091070_24517_25446 | 286 |
| 6 | 3300042601 | Ga0466707_106253 | Ga0466707_106253_33466_34380 | 287 |
| 7 | 3300010167 | Ga0123353_10160117 | Ga0123353_101601174 | 288 |
| 8 | 3300042619 | Ga0466726_485267 | Ga0466726_485267_545_1477 | 288 |
| 9 | 3300042611 | Ga0466697_280414 | Ga0466697_280414_50_922 | 290 |
| 10 | 3300042596 | Ga0466696_312354 | Ga0466696_312354_32_910 | 292 |
| 11 | iso_pr_bacteria | 2537562000 | 2539434015 | 294 |
| 12 | iso_pr_bacteria | 2563367190 | 2565787012 | 294 |
| 13 | iso_pr_bacteria | 2820301196 | 2820302144 | 294 |
| 14 | iso_pr_bacteria | 2822232166 | 2822235895 | 294 |
| 15 | iso_pr_bacteria | 2864782175 | 2864783946 | 294 |
| 16 | iso_pr_bacteria | 2912849059 | 2912853700 | 294 |
| 17 | iso_pr_bacteria | 2916873227 | 2916879443 | 294 |
| 18 | iso_pr_bacteria | 2969145278 | 2969149050 | 294 |
| 19 | iso_pr_bacteria | 2978778678 | 2978782223 | 294 |
| 20 | iso_pr_bacteria | 643886085 | 644681887 | 294 |
| 21 | iso_pr_bacteria | 643886091 | 644650573 | 294 |
| 22 | iso_pr_bacteria | 8022725327 | 8022727086 | 294 |
| 23 | iso_pr_bacteria | 8022781829 | 8022783584 | 294 |
| 24 | iso_pr_bacteria | 8061039349 | 8061044766 | 294 |
| 25 | iso_pr_bacteria | 8061045771 | 8061049557 | 294 |
| 26 | iso_pr_bacteria | 8061100935 | 8061104871 | 294 |
| 27 | 3300002501 | JGI24703J35330_11732838 | JGI24703J35330_117328382 | 295 |
| 28 | 3300002501 | JGI24703J35330_11745445 | JGI24703J35330_117454454 | 295 |
| 29 | 3300002501 | JGI24703J35330_11746237 | JGI24703J35330_117462373 | 295 |
| 30 | 3300002501 | JGI24703J35330_11747588 | JGI24703J35330_117475886 | 295 |
| 31 | 3300002507 | JGI24697J35500_11273298 | JGI24697J35500_112732982 | 295 |
| 32 | 3300002508 | JGI24700J35501_10849990 | JGI24700J35501_108499901 | 295 |
| 33 | 3300002508 | JGI24700J35501_10930817 | JGI24700J35501_1093081713 | 295 |
| 34 | 3300005201 | Ga0072941_1059063 | Ga0072941_105906314 | 295 |
| 35 | 3300009826 | Ga0123355_10004025 | Ga0123355_1000402514 | 295 |
| 36 | 3300009826 | Ga0123355_10038641 | Ga0123355_100386416 | 295 |
| 37 | 3300009826 | Ga0123355_10039985 | Ga0123355_100399855 | 295 |
| 38 | 3300009826 | Ga0123355_10098550 | Ga0123355_100985503 | 295 |
| 39 | 3300009826 | Ga0123355_10138664 | Ga0123355_101386645 | 295 |
| 40 | 3300009826 | Ga0123355_10031758 | Ga0123355_100317582 | 296 |
| 41 | 3300009826 | Ga0123355_10395654 | Ga0123355_103956542 | 296 |
| 42 | iso_pr_bacteria | 2820693137 | 2820695266 | 296 |
| 43 | 3300002450 | JGI24695J34938_10069575 | JGI24695J34938_100695752 | 297 |
| 44 | 3300042596 | Ga0466696_365644 | Ga0466696_365644_289_1257 | 297 |
| 45 | 2225789004 | 2227090010 | 2227468634 | 298 |
| 46 | 3300042616 | Ga0466715_097016 | Ga0466715_097016_5778_6674 | 298 |
| 47 | iso_pr_bacteria | 2645727721 | 2646683575 | 298 |
| 48 | iso_pr_bacteria | 2684622911 | 2686072807 | 298 |
| 49 | iso_pr_bacteria | 2684622912 | 2686074707 | 298 |
| 50 | iso_pr_bacteria | 2684622913 | 2686076319 | 298 |
| 51 | iso_pr_bacteria | 2758568511 | 2760261259 | 298 |
| 52 | iso_pr_bacteria | 2758568513 | 2760264804 | 298 |
| 53 | iso_pr_bacteria | 2758568514 | 2760266681 | 298 |
| 54 | iso_pr_bacteria | 2758568515 | 2760268736 | 298 |
| 55 | iso_pr_bacteria | 2758568558 | 2760423564 | 298 |
| 56 | iso_pr_bacteria | 2758568559 | 2760425915 | 298 |
| 57 | iso_pr_bacteria | 2758568560 | 2760427847 | 298 |
| 58 | iso_pr_bacteria | 2758568561 | 2760428997 | 298 |
| 59 | iso_pr_bacteria | 2808606958 | 2811757595 | 298 |
| 60 | iso_pr_bacteria | 2877513988 | 2877514046 | 298 |
| 61 | iso_pr_bacteria | 2896843662 | 2896846112 | 298 |
| 62 | iso_pr_bacteria | 2912324399 | 2912324441 | 298 |
| 63 | iso_pr_bacteria | 2961515617 | 2961515689 | 298 |
| 64 | iso_pr_bacteria | 2979949929 | 2979949991 | 298 |
| 65 | iso_pr_bacteria | 3004719924 | 3004721428 | 298 |
| 66 | iso_pr_bacteria | 8017462664 | 8017462741 | 298 |
| 67 | iso_pr_bacteria | 8017489919 | 8017490620 | 298 |
| 68 | iso_pr_bacteria | 8017536074 | 8017536132 | 298 |
| 69 | 3300002834 | JGI24696J40584_12959644 | JGI24696J40584_129596446 | 299 |
| 70 | 3300009784 | Ga0123357_10090522 | Ga0123357_100905222 | 299 |
| 71 | 3300041968 | Ga0456237_0003896 | Ga0456237_0003896_1295_2194 | 299 |
| 72 | 3300042591 | Ga0466692_191207 | Ga0466692_191207_5360_6259 | 299 |
| 73 | 3300042623 | Ga0466734_160894 | Ga0466734_160894_128_1027 | 299 |
| 74 | 3300056790 | Ga0562379_0005 | Ga0562379_0005_1468215_1469114 | 299 |
| 75 | 3300056790 | Ga0562379_0035 | Ga0562379_0035_429996_430895 | 299 |
| 76 | 3300056790 | Ga0562379_0073 | Ga0562379_0073_261616_262515 | 299 |
| 77 | 3300056790 | Ga0562379_0231 | Ga0562379_0231_32136_33035 | 299 |
| 78 | 3300056790 | Ga0562379_0363 | Ga0562379_0363_44704_45603 | 299 |
| 79 | 3300056790 | Ga0562379_0745 | Ga0562379_0745_2635_3534 | 299 |
| 80 | 3300056790 | Ga0562379_0864 | Ga0562379_0864_3219_4118 | 299 |
| 81 | 3300056842 | Ga0562377_0019 | Ga0562377_0019_643730_644629 | 299 |
| 82 | 3300056842 | Ga0562377_0063 | Ga0562377_0063_129335_130234 | 299 |
| 83 | 3300056842 | Ga0562377_0264 | Ga0562377_0264_35726_36625 | 299 |
| 84 | 3300056842 | Ga0562377_0882 | Ga0562377_0882_12352_13251 | 299 |
| 85 | 3300056856 | Ga0562375_0005 | Ga0562375_0005_1536104_1537003 | 299 |
| 86 | 3300056856 | Ga0562375_0009 | Ga0562375_0009_1598398_1599297 | 299 |
| 87 | 3300056856 | Ga0562375_0013 | Ga0562375_0013_420064_420963 | 299 |
| 88 | 3300056856 | Ga0562375_0096 | Ga0562375_0096_49314_50213 | 299 |
| 89 | 3300056856 | Ga0562375_0100 | Ga0562375_0100_195651_196550 | 299 |
| 90 | 3300057007 | Ga0562374_0006 | Ga0562374_0006_117137_118036 | 299 |
| 91 | 3300057007 | Ga0562374_0008 | Ga0562374_0008_109876_110775 | 299 |
| 92 | 3300057007 | Ga0562374_1386 | Ga0562374_1386_18776_19675 | 299 |
| 93 | iso_pr_bacteria | 2576861670 | 2579167117 | 299 |
| 94 | iso_pr_bacteria | 2595698190 | 2596205849 | 299 |
| 95 | iso_pr_bacteria | 2595698193 | 2596211257 | 299 |
| 96 | iso_pr_bacteria | 2595698194 | 2596213050 | 299 |
| 97 | iso_pr_bacteria | 2595698195 | 2596214946 | 299 |
| 98 | iso_pr_bacteria | 2595698196 | 2596216760 | 299 |
| 99 | iso_pr_bacteria | 2595698197 | 2596218597 | 299 |
| 100 | iso_pr_bacteria | 2595698198 | 2596220428 | 299 |
| 101 | iso_pr_bacteria | 2595698199 | 2596222240 | 299 |
| 102 | iso_pr_bacteria | 2597490293 | 2598964242 | 299 |
| 103 | iso_pr_bacteria | 2622736579 | 2623392465 | 299 |
| 104 | iso_pr_bacteria | 2627853628 | 2628280623 | 299 |
| 105 | iso_pr_bacteria | 2690315820 | 2691200911 | 299 |
| 106 | iso_pr_bacteria | 2718218475 | 2721609113 | 299 |
| 107 | iso_pr_bacteria | 2728369362 | 2730151987 | 299 |
| 108 | iso_pr_bacteria | 2740892556 | 2743947488 | 299 |
| 109 | iso_pr_bacteria | 2770939318 | 2771021755 | 299 |
| 110 | iso_pr_bacteria | 2775507073 | 2777018416 | 299 |
| 111 | iso_pr_bacteria | 2825804107 | 2825804394 | 299 |
| 112 | iso_pr_bacteria | 2881375749 | 2881377351 | 299 |
| 113 | iso_pr_bacteria | 2890957088 | 2890961178 | 299 |
| 114 | iso_pr_bacteria | 2937236879 | 2937239408 | 299 |
| 115 | iso_pr_bacteria | 2940218408 | 2940218687 | 299 |
| 116 | iso_pr_bacteria | 2940261461 | 2940261737 | 299 |
| 117 | iso_pr_bacteria | 2957623355 | 2957623839 | 299 |
| 118 | iso_pr_bacteria | 2960772748 | 2960774777 | 299 |
| 119 | iso_pr_bacteria | 2964739456 | 2964742546 | 299 |
| 120 | iso_pr_bacteria | 2964749277 | 2964750046 | 299 |
| 121 | iso_pr_bacteria | 2964765680 | 2964767813 | 299 |
| 122 | iso_pr_bacteria | 2964775400 | 2964777863 | 299 |
| 123 | iso_pr_bacteria | 2964778705 | 2964780784 | 299 |
| 124 | iso_pr_bacteria | 2967802344 | 2967805668 | 299 |
| 125 | iso_pr_bacteria | 2967825073 | 2967826029 | 299 |
| 126 | iso_pr_bacteria | 2970225615 | 2970228943 | 299 |
| 127 | iso_pr_bacteria | 2970254690 | 2970255874 | 299 |
| 128 | iso_pr_bacteria | 2977592972 | 2977596069 | 299 |
| 129 | iso_pr_bacteria | 2977596371 | 2977599468 | 299 |
| 130 | iso_pr_bacteria | 2977622177 | 2977625230 | 299 |
| 131 | iso_pr_bacteria | 2977628635 | 2977630793 | 299 |
| 132 | iso_pr_bacteria | 2977635137 | 2977638400 | 299 |
| 133 | iso_pr_bacteria | 2977653127 | 2977656329 | 299 |
| 134 | iso_pr_bacteria | 647533136 | 647748159 | 299 |
| 135 | iso_pr_bacteria | 650716050 | 650845220 | 299 |
| 136 | iso_pr_bacteria | 8002299145 | 8002300366 | 299 |
| 137 | iso_pr_bacteria | 8007211731 | 8007213428 | 299 |
| 138 | iso_pr_bacteria | 8007215774 | 8007218486 | 299 |
| 139 | iso_pr_bacteria | 8007220153 | 8007222926 | 299 |
| 140 | iso_pr_bacteria | 8007223943 | 8007225765 | 299 |
| 141 | iso_pr_bacteria | 8007237282 | 8007240605 | 299 |
| 142 | iso_pr_bacteria | 8012939035 | 8012939414 | 299 |
| 143 | iso_pr_bacteria | 8018750880 | 8018753763 | 299 |
| 144 | iso_pr_bacteria | 8018754795 | 8018755993 | 299 |
| 145 | iso_pr_bacteria | 8018794549 | 8018797375 | 299 |
| 146 | iso_pr_bacteria | 8018798118 | 8018800119 | 299 |
| 147 | iso_pr_bacteria | 8018802046 | 8018804924 | 299 |
| 148 | iso_pr_bacteria | 8038268975 | 8038271345 | 299 |
| 149 | iso_pr_bacteria | 8077780672 | 8077781954 | 299 |
| 150 | iso_pr_bacteria | 8108568626 | 8108568799 | 299 |
| 151 | iso_pr_bacteria | 8108568626 | 8108570025 | 299 |
| 152 | iso_pr_bacteria | 8108576847 | 8108577225 | 299 |
| 153 | iso_pr_bacteria | 8114537524 | 8114538218 | 299 |
| 154 | iso_pr_bacteria | 8114541043 | 8114541576 | 299 |
| 155 | iso_pr_bacteria | 8114544644 | 8114544852 | 299 |
| 156 | iso_pr_bacteria | 8114549044 | 8114549422 | 299 |
| 157 | iso_pr_bacteria | 8114555646 | 8114555819 | 299 |
| 158 | iso_pr_bacteria | 8114555646 | 8114557045 | 299 |
| 159 | 3300002932 | CVPL010L_1001570 | CVPL010L_10015703 | 300 |
| 160 | 3300007767 | Ga0105553_1088541 | Ga0105553_10885412 | 300 |
| 161 | 3300042601 | Ga0466707_120204 | Ga0466707_120204_6458_7360 | 300 |
| 162 | 3300042609 | Ga0466722_017663 | Ga0466722_017663_2400_3302 | 300 |
| 163 | 3300042611 | Ga0466697_192943 | Ga0466697_192943_1107_2009 | 300 |
| 164 | 3300042649 | Ga0466724_56909 | Ga0466724_56909_4661_5563 | 300 |
| 165 | iso_pr_bacteria | 2873581347 | 2873582982 | 300 |
| 166 | 3300002449 | JGI24698J34947_10012730 | JGI24698J34947_100127303 | 301 |
| 167 | 3300042600 | Ga0466700_125904 | Ga0466700_125904_16613_17518 | 301 |
| 168 | 3300042614 | Ga0466712_009968 | Ga0466712_009968_5031_5936 | 301 |
| 169 | 3300042614 | Ga0466712_072724 | Ga0466712_072724_2807_3712 | 301 |
| 170 | 3300042614 | Ga0466712_101966 | Ga0466712_101966_533_1438 | 301 |
| 171 | 3300042614 | Ga0466712_113890 | Ga0466712_113890_2038_2943 | 301 |
| 172 | 3300042614 | Ga0466712_221181 | Ga0466712_221181_7478_8383 | 301 |
| 173 | 3300042624 | Ga0466735_192787 | Ga0466735_192787_28_933 | 301 |
| 174 | iso_pr_bacteria | 2524614537 | 2524834349 | 301 |
| 175 | iso_pr_bacteria | 2585428141 | 2588055477 | 301 |
| 176 | iso_pr_bacteria | 2751185832 | 2753510822 | 301 |
| 177 | iso_pr_bacteria | 2820406809 | 2820408724 | 301 |
| 178 | iso_pr_bacteria | 2843246524 | 2843249484 | 301 |
| 179 | iso_pr_bacteria | 2852123468 | 2852124049 | 301 |
| 180 | iso_pr_bacteria | 2855361764 | 2855365360 | 301 |
| 181 | iso_pr_bacteria | 2873593402 | 2873594049 | 301 |
| 182 | iso_pr_bacteria | 2873597894 | 2873599088 | 301 |
| 183 | iso_pr_bacteria | 2923762712 | 2923763142 | 301 |
| 184 | iso_pr_bacteria | 2936628749 | 2936629936 | 301 |
| 185 | iso_pr_bacteria | 8066790652 | 8066792323 | 301 |
| 186 | iso_pr_bacteria | 8066792404 | 8066793834 | 301 |
| 187 | iso_pr_bacteria | 8066794103 | 8066794447 | 301 |
| 188 | iso_pr_bacteria | 8066795793 | 8066797510 | 301 |
| 189 | iso_pr_bacteria | 8066797744 | 8066799173 | 301 |
| 190 | iso_pr_bacteria | 8066799369 | 8066800766 | 301 |
| 191 | iso_pr_bacteria | 8066802609 | 8066804098 | 301 |
| 192 | 3300002449 | JGI24698J34947_10000311 | JGI24698J34947_100003116 | 302 |
| 193 | 3300002449 | JGI24698J34947_10000844 | JGI24698J34947_100008443 | 302 |
| 194 | 3300002449 | JGI24698J34947_10000892 | JGI24698J34947_100008929 | 302 |
| 195 | 3300002449 | JGI24698J34947_10005559 | JGI24698J34947_100055593 | 302 |
| 196 | 3300002449 | JGI24698J34947_10011833 | JGI24698J34947_100118333 | 302 |
| 197 | 3300002449 | JGI24698J34947_10034459 | JGI24698J34947_100344593 | 302 |
| 198 | 3300002449 | JGI24698J34947_10052395 | JGI24698J34947_100523951 | 302 |
| 199 | 3300010167 | Ga0123353_10129141 | Ga0123353_101291413 | 302 |
| 200 | 3300010882 | Ga0123354_10023525 | Ga0123354_1002352510 | 302 |
| 201 | 3300038395 | Ga0415639_043799 | Ga0415639_043799_7128_8036 | 302 |
| 202 | 3300042624 | Ga0466735_013597 | Ga0466735_013597_50377_51285 | 302 |
| 203 | iso_pr_bacteria | 2820290662 | 2820290913 | 302 |
| 204 | 3300042601 | Ga0466707_344657 | Ga0466707_344657_961_1872 | 303 |
| 205 | 3300042625 | Ga0466730_024608 | Ga0466730_024608_5616_6527 | 303 |
| 206 | 3300056564 | Ga0530661_000258 | Ga0530661_000258_14539_15450 | 303 |
| 207 | iso_pr_bacteria | 2820644600 | 2820646511 | 303 |
| 208 | 3300005201 | Ga0072941_1002644 | Ga0072941_100264414 | 304 |
| 209 | 3300010167 | Ga0123353_10915876 | Ga0123353_109158762 | 304 |
| 210 | 3300010882 | Ga0123354_10129766 | Ga0123354_101297663 | 304 |
| 211 | 3300042591 | Ga0466692_131728 | Ga0466692_131728_12405_13433 | 304 |
| 212 | iso_pr_bacteria | 2820733257 | 2820733887 | 304 |
| 213 | iso_pr_bacteria | 2828301124 | 2828301314 | 304 |
| 214 | iso_pr_bacteria | 8064531044 | 8064531562 | 304 |
| 215 | 3300010049 | Ga0123356_10016974 | Ga0123356_100169742 | 305 |
| 216 | 3300010167 | Ga0123353_10086059 | Ga0123353_100860592 | 305 |
| 217 | 3300042601 | Ga0466707_052901 | Ga0466707_052901_20545_21510 | 305 |
| 218 | 3300042601 | Ga0466707_154618 | Ga0466707_154618_4315_5232 | 305 |
| 219 | 3300042601 | Ga0466707_233573 | Ga0466707_233573_735_1652 | 305 |
| 220 | 3300042619 | Ga0466726_052608 | Ga0466726_052608_3838_4755 | 305 |
| 221 | 3300042659 | Ga0466733_120672 | Ga0466733_120672_13835_14752 | 305 |
| 222 | iso_pr_bacteria | 2619619079 | 2620606280 | 305 |
| 223 | 3300038395 | Ga0415639_002705 | Ga0415639_002705_17922_18842 | 306 |
| 224 | 3300038395 | Ga0415639_208694 | Ga0415639_208694_2056_2976 | 306 |
| 225 | 3300042609 | Ga0466722_246602 | Ga0466722_246602_5149_6069 | 306 |
| 226 | 3300042616 | Ga0466715_418785 | Ga0466715_418785_639_1559 | 306 |
| 227 | iso_pr_bacteria | 2820309449 | 2820311134 | 306 |
| 228 | iso_pr_bacteria | 2820602899 | 2820603069 | 306 |
| 229 | 3300002508 | JGI24700J35501_10930816 | JGI24700J35501_1093081619 | 307 |
| 230 | 3300009826 | Ga0123355_10000621 | Ga0123355_1000062129 | 307 |
| 231 | 3300042659 | Ga0466733_062564 | Ga0466733_062564_15879_16802 | 307 |
| 232 | 3300009826 | Ga0123355_10014213 | Ga0123355_100142136 | 308 |
| 233 | 3300009826 | Ga0123355_10080377 | Ga0123355_100803772 | 308 |
| 234 | 3300010049 | Ga0123356_10122078 | Ga0123356_101220782 | 308 |
| 235 | 3300010167 | Ga0123353_10444674 | Ga0123353_104446742 | 308 |
| 236 | 3300010167 | Ga0123353_10926471 | Ga0123353_109264712 | 308 |
| 237 | 3300042611 | Ga0466697_145326 | Ga0466697_145326_1251_2270 | 308 |
| 238 | iso_pr_bacteria | 2864955722 | 2864959963 | 308 |
| 239 | iso_pr_bacteria | 643886087 | 644669507 | 308 |
| 240 | iso_pr_bacteria | 643886090 | 644663451 | 308 |
| 241 | 2225789004 | 2227150830 | 2227556628 | 309 |
| 242 | 3300005200 | Ga0072940_1099348 | Ga0072940_10993484 | 309 |
| 243 | 3300010882 | Ga0123354_10046303 | Ga0123354_100463033 | 309 |
| 244 | 3300042596 | Ga0466696_233238 | Ga0466696_233238_445_1374 | 309 |
| 245 | 3300056564 | Ga0530661_042219 | Ga0530661_042219_379_1308 | 309 |
| 246 | iso_pr_bacteria | 2820596822 | 2820598410 | 309 |
| 247 | iso_pr_bacteria | 2820734335 | 2820735353 | 309 |
| 248 | 3300009826 | Ga0123355_10045932 | Ga0123355_100459322 | 310 |
| 249 | 3300010167 | Ga0123353_10005780 | Ga0123353_100057804 | 310 |
| 250 | 3300009826 | Ga0123355_10088251 | Ga0123355_100882514 | 311 |
| 251 | 3300010167 | Ga0123353_10959585 | Ga0123353_109595852 | 311 |
| 252 | iso_pr_bacteria | 2820501819 | 2820504035 | 311 |
| 253 | 3300010167 | Ga0123353_10447995 | Ga0123353_104479952 | 312 |
| 254 | 3300042592 | Ga0466693_194138 | Ga0466693_194138_46_984 | 312 |
| 255 | 3300042594 | Ga0466694_205019 | Ga0466694_205019_325_1263 | 312 |
| 256 | 3300042601 | Ga0466707_083766 | Ga0466707_083766_9621_10580 | 312 |
| 257 | 3300042603 | Ga0466714_064292 | Ga0466714_064292_36017_36955 | 312 |
| 258 | 3300000062 | IMNBL1DRAFT_c0010389 | IMNBL1DRAFT_00103893 | 313 |
| 259 | 3300002462 | JGI24702J35022_10126241 | JGI24702J35022_101262412 | 313 |
| 260 | 3300010882 | Ga0123354_10280901 | Ga0123354_102809012 | 313 |
| 261 | 3300042602 | Ga0466713_059769 | Ga0466713_059769_132127_133068 | 313 |
| 262 | 3300042616 | Ga0466715_226389 | Ga0466715_226389_15857_16798 | 313 |
| 263 | 3300042616 | Ga0466715_547364 | Ga0466715_547364_3604_4545 | 313 |
| 264 | 3300042659 | Ga0466733_101104 | Ga0466733_101104_83_1024 | 313 |
| 265 | 3300042601 | Ga0466707_318547 | Ga0466707_318547_1368_2357 | 314 |
| 266 | 3300042606 | Ga0466719_456299 | Ga0466719_456299_402_1508 | 314 |
| 267 | 3300042616 | Ga0466715_067285 | Ga0466715_067285_9288_10235 | 315 |
| 268 | 3300042619 | Ga0466726_037128 | Ga0466726_037128_4747_5694 | 315 |
| 269 | 3300010049 | Ga0123356_10511735 | Ga0123356_105117352 | 316 |
| 270 | 3300042596 | Ga0466696_114898 | Ga0466696_114898_271_1221 | 316 |
| 271 | 3300042636 | Ga0466703_266629 | Ga0466703_266629_1156_2172 | 316 |
| 272 | 3300057007 | Ga0562374_0568 | Ga0562374_0568_19332_20282 | 316 |
| 273 | 3300042655 | Ga0466727_045726 | Ga0466727_045726_3310_4473 | 317 |
| 274 | iso_pr_bacteria | 2820516196 | 2820517557 | 317 |
| 275 | 3300042604 | Ga0466717_055277 | Ga0466717_055277_94_1050 | 318 |
| 276 | iso_pr_bacteria | 2820626145 | 2820626616 | 318 |
| 277 | iso_pr_bacteria | 2820950349 | 2820951043 | 320 |
| 278 | 3300010167 | Ga0123353_10033378 | Ga0123353_100333783 | 321 |
| 279 | 3300042602 | Ga0466713_135694 | Ga0466713_135694_5623_6645 | 321 |
| 280 | 3300042615 | Ga0466711_406868 | Ga0466711_406868_1498_2535 | 321 |
| 281 | 2225789004 | 2227494095 | 2227969635 | 322 |
| 282 | 3300010049 | Ga0123356_10154554 | Ga0123356_101545542 | 322 |
| 283 | 3300010882 | Ga0123354_10118954 | Ga0123354_101189541 | 322 |
| 284 | 3300042600 | Ga0466700_414066 | Ga0466700_414066_174_1142 | 322 |
| 285 | 3300042621 | Ga0466729_316237 | Ga0466729_316237_7851_8819 | 322 |
| 286 | 3300042623 | Ga0466734_019526 | Ga0466734_019526_645_1613 | 322 |
| 287 | 3300042623 | Ga0466734_161874 | Ga0466734_161874_978_1946 | 322 |
| 288 | 3300042655 | Ga0466727_265395 | Ga0466727_265395_146_1282 | 322 |
| 289 | 3300010882 | Ga0123354_10143987 | Ga0123354_101439872 | 323 |
| 290 | 3300042591 | Ga0466692_046574 | Ga0466692_046574_2990_4009 | 323 |
| 291 | 3300042623 | Ga0466734_006750 | Ga0466734_006750_3201_4172 | 323 |
| 292 | 3300010049 | Ga0123356_10047255 | Ga0123356_100472551 | 324 |
| 293 | 3300042601 | Ga0466707_011603 | Ga0466707_011603_1311_2360 | 324 |
| 294 | 3300042596 | Ga0466696_286602 | Ga0466696_286602_1238_2272 | 325 |
| 295 | 3300002462 | JGI24702J35022_10100723 | JGI24702J35022_101007232 | 326 |
| 296 | 3300042594 | Ga0466694_222635 | Ga0466694_222635_709_1689 | 326 |
| 297 | 3300042602 | Ga0466713_026803 | Ga0466713_026803_44974_45954 | 326 |
| 298 | 3300042617 | Ga0466718_020487 | Ga0466718_020487_70_1050 | 326 |
| 299 | 3300042643 | Ga0466704_128930 | Ga0466704_128930_10131_11219 | 326 |
| 300 | 3300042601 | Ga0466707_065903 | Ga0466707_065903_689_1672 | 327 |
| 301 | 3300042620 | Ga0466728_178759 | Ga0466728_178759_4198_5214 | 327 |
| 302 | 3300042643 | Ga0466704_504111 | Ga0466704_504111_198_1292 | 329 |
| 303 | 3300042652 | Ga0466708_114903 | Ga0466708_114903_41102_42109 | 329 |
| 304 | 3300042601 | Ga0466707_172858 | Ga0466707_172858_5498_6490 | 330 |
| 305 | 3300042601 | Ga0466707_243590 | Ga0466707_243590_2144_3136 | 330 |
| 306 | 3300042601 | Ga0466707_359476 | Ga0466707_359476_2353_3345 | 330 |
| 307 | 3300042616 | Ga0466715_146475 | Ga0466715_146475_2792_3889 | 330 |
| 308 | 3300042636 | Ga0466703_117476 | Ga0466703_117476_1424_2416 | 330 |
| 309 | 3300010049 | Ga0123356_10018538 | Ga0123356_100185382 | 331 |
| 310 | 3300010167 | Ga0123353_10307384 | Ga0123353_103073842 | 331 |
| 311 | 3300009784 | Ga0123357_10035602 | Ga0123357_100356023 | 332 |
| 312 | 3300010049 | Ga0123356_10013031 | Ga0123356_100130314 | 332 |
| 313 | 3300010049 | Ga0123356_10039591 | Ga0123356_100395914 | 332 |
| 314 | 3300042609 | Ga0466722_086033 | Ga0466722_086033_137_1135 | 332 |
| 315 | 3300042601 | Ga0466707_233622 | Ga0466707_233622_6424_7425 | 333 |
| 316 | 3300042609 | Ga0466722_060541 | Ga0466722_060541_323_1324 | 333 |
| 317 | 3300042619 | Ga0466726_252095 | Ga0466726_252095_2605_3636 | 333 |
| 318 | 3300010167 | Ga0123353_10121090 | Ga0123353_101210905 | 334 |
| 319 | 3300038395 | Ga0415639_185778 | Ga0415639_185778_1286_2290 | 334 |
| 320 | 3300042601 | Ga0466707_181727 | Ga0466707_181727_6942_7952 | 336 |
| 321 | 3300042601 | Ga0466707_224672 | Ga0466707_224672_1240_2250 | 336 |
| 322 | 3300010049 | Ga0123356_10016162 | Ga0123356_100161622 | 337 |
| 323 | 3300010882 | Ga0123354_10177455 | Ga0123354_101774552 | 337 |
| 324 | 3300042606 | Ga0466719_045714 | Ga0466719_045714_613_1692 | 337 |
| 325 | 3300010049 | Ga0123356_10012351 | Ga0123356_100123514 | 339 |
| 326 | 3300010167 | Ga0123353_10134245 | Ga0123353_101342453 | 339 |
| 327 | 3300010167 | Ga0123353_10165298 | Ga0123353_101652982 | 339 |
| 328 | 3300010167 | Ga0123353_10305520 | Ga0123353_103055202 | 339 |
| 329 | 3300010167 | Ga0123353_10804060 | Ga0123353_108040601 | 339 |
| 330 | 3300042620 | Ga0466728_001147 | Ga0466728_001147_1022_2041 | 339 |
| 331 | 3300010167 | Ga0123353_10074706 | Ga0123353_100747062 | 342 |
| 332 | 3300010167 | Ga0123353_10201478 | Ga0123353_102014783 | 342 |
| 333 | 3300042652 | Ga0466708_295249 | Ga0466708_295249_8052_9146 | 345 |
| 334 | 3300042606 | Ga0466719_155889 | Ga0466719_155889_1853_2893 | 346 |
| 335 | 3300009784 | Ga0123357_10153687 | Ga0123357_101536872 | 347 |
| 336 | 3300042612 | Ga0466705_197008 | Ga0466705_197008_15215_16258 | 347 |
| 337 | 3300042636 | Ga0466703_038561 | Ga0466703_038561_228_1271 | 347 |
| 338 | 3300042623 | Ga0466734_165511 | Ga0466734_165511_32_1078 | 348 |
| 339 | 3300042596 | Ga0466696_010017 | Ga0466696_010017_1788_2855 | 355 |
| 340 | 3300042643 | Ga0466704_004753 | Ga0466704_004753_13578_14750 | 355 |
| 341 | 3300042598 | Ga0466701_051645 | Ga0466701_051645_355_1437 | 360 |
| 342 | 3300009784 | Ga0123357_10015989 | Ga0123357_100159893 | 363 |
| 343 | 3300042616 | Ga0466715_631008 | Ga0466715_631008_85_1212 | 375 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.75 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.