Protein Family IF07850

Metagenome Isolate
343 Members
197 Samples
201 Scaffolds
307.2 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_631008|Ga0466715_631008_85_1212
Length
375 aa
Sequence
MLRLVCGLRLAKKNRAAAAKLLDKRLGMSDNRCIKWRGKSLGLLQALMPLQECARDKRQKRKRELMVELKSVCKSFGSVQALKNISISAGSGRAYGLLGRNGAGKTTTLRIIMDIFKPDRGTVLIDGKPAGKSNARIGYLPEERGLYPRRLVGEQMVYIGVLRGLSKETAQRNAKRLLKELEVPEYYQRKLETLSKGNQQKIQLAVALISEPDLLILDEPFSGLDPVNAKILKDIVKKQSAEGKTILFSSHQMSQVEEFCEEICIINKGEKVLEGRIDDIKRSYPRNIYYVSVGGFAADEFLTAVMRQMGSWCKGIRRKGPGFEVALVEPSARGMLFDAIRQQGLTPEVFTVKEPTLEEIFVEKAGGSDETGEEN

πŸ“Š Sample Types

Isolate 41.4%
Metagenome 58.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 25.6%
Termitidae 16.1%
Drosophilidae 12.2%
Apidae 9.4%
Kalotermitidae 5.6%
Halictidae 5.0%
Pyralidae 3.3%
Tenebrionidae 3.3%
Rhinotermitidae 2.8%
Scarabaeidae 2.8%
Bombycidae 1.7%
Termopsidae 1.7%
Formicidae 1.7%
Elmidae 1.1%
Blattidae 1.1%
Passalidae 1.1%
Libellulidae 0.6%
Hydrophilidae 0.6%
Noctuidae 0.6%
Eresidae 0.6%
Culicidae 0.6%
Dytiscidae 0.6%
Gomphidae 0.6%
Ocypodidae 0.6%
Vespidae 0.6%
Portunidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 323
Eukaryota 0
Viruses 0
Unclassified 20

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
2 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
3 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
4 2595698199 Melissococcus plutonius 60 Isolate Apidae
5 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
10 8007237282 Enterococcus sp. DIV0212c Isolate
11 8017489919 Lactobacillus brevis EF Isolate Unclassified
12 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
13 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
14 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
15 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
16 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
17 3004719924 Lactobacillus sp. W8174 Isolate Apidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
21 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
22 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
23 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
24 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
25 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
26 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
27 2595698197 Melissococcus plutonius H6 Isolate Apidae
28 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
29 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
30 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
31 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
32 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
33 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
34 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
35 8022725327 Bacillus sp. SN10 Isolate Eresidae
36 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
37 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
38 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
39 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
40 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
41 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
42 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
43 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
49 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
50 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
51 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
52 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
53 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
54 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
55 2820734335 Unclassified Chloroflexi Lab288P3bin99 Isolate Unclassified
56 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
57 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
58 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
59 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
60 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
61 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
62 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
63 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
64 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
65 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
66 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
67 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
68 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
69 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
70 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
71 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
72 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
73 2537562000 Bacillus cereus HD73 Isolate Pyralidae
74 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
75 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
76 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
77 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
78 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
79 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
80 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
81 8108568626 Enterococcus sp. DIV1094 Isolate
82 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
83 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
84 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
85 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
86 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
87 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
88 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
89 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
90 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
91 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
92 2595698195 Melissococcus plutonius 119 Isolate Apidae
93 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
94 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
95 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
96 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
97 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
98 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
99 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
100 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
101 8007223943 Enterococcus sp. MSG2901 Isolate
102 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
103 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
104 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
105 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
106 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
107 2978778678 Bacillus cereus 25 Isolate Ocypodidae
108 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
109 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
110 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
111 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
112 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
113 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
114 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
115 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
116 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
117 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
118 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
119 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
120 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
121 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
122 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
123 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
124 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
125 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
126 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
127 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
128 2595698193 Melissococcus plutonius B5 Isolate Apidae
129 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
130 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
131 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
132 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
133 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
134 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
135 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
136 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
137 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
138 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
139 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
140 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
141 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
142 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
143 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
144 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
145 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
146 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
147 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
148 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
149 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
150 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
151 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
152 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
153 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
154 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
155 8114555646 Enterococcus sp. DIV1094 Isolate
156 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
157 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
158 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
159 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
160 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
161 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
162 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
163 2627853628 Melissococcus plutonius 82 Isolate Apidae
164 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
165 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
166 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
167 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
168 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
169 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
170 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
171 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
172 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
173 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
174 2969145278 Bacillus cereus 29 Isolate Portunidae
175 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
176 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
177 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
178 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
179 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
180 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
181 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
182 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
183 2595698198 Melissococcus plutonius L9 Isolate Apidae
184 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
185 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
186 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
187 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
188 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
189 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
190 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
191 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
192 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
193 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
194 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
195 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
196 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
197 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_042219 3300056564 Bacteria 1326
2 Ga0562379_0035 3300056790 Bacteria 679259
3 Ga0562379_0073 3300056790 Bacteria 410385
4 Ga0562379_0745 3300056790 Bacteria 54476
5 Ga0562375_0005 3300056856 Bacteria 2472444
6 2227494095 2225789004 Bacteria 3997
7 JGI24698J34947_10000892 3300002449 Bacteria 15123
8 JGI24698J34947_10052395 3300002449 Unclassified 2048
9 JGI24702J35022_10100723 3300002462 Bacteria 1581
10 JGI24702J35022_10126241 3300002462 Bacteria 1417
11 JGI24700J35501_10849990 3300002508 Bacteria 1966
12 Ga0466735_013597 3300042624 Bacteria 199947
13 Ga0466703_038561 3300042636 Bacteria 1325
14 Ga0466703_117476 3300042636 Bacteria 29454
15 Ga0466718_020487 3300042617 Bacteria 1285
16 Ga0456237_0003896 3300041968 Bacteria 2406
17 Ga0123355_10098550 3300009826 Bacteria 4610
18 Ga0123356_10016974 3300010049 Bacteria 6934
19 Ga0123353_10160117 3300010167 Bacteria 3585
20 Ga0466707_065903 3300042601 Bacteria 3814
21 Ga0466707_120204 3300042601 Bacteria 23436
22 Ga0466697_145326 3300042611 Bacteria 3536
23 Ga0562375_0100 3300056856 Bacteria 265693
24 Ga0562374_1386 3300057007 Unclassified 28696
25 JGI24698J34947_10012730 3300002449 Bacteria 4606
26 JGI24703J35330_11747588 3300002501 Bacteria 7396
27 JGI24697J35500_11273298 3300002507 Bacteria 5525
28 Ga0466729_316237 3300042621 Bacteria 22092
29 Ga0466734_006750 3300042623 Bacteria 5095
30 Ga0466704_004753 3300042643 Bacteria 14844
31 Ga0466708_114903 3300042652 Bacteria 49445
32 Ga0466715_226389 3300042616 Bacteria 29197
33 Ga0466728_178759 3300042620 Bacteria 5871
34 Ga0466692_131728 3300042591 Bacteria 45931
35 Ga0466696_286602 3300042596 Bacteria 3571
36 Ga0123357_10090522 3300009784 Unclassified 3990
37 Ga0123355_10000621 3300009826 Bacteria 47975
38 Ga0123355_10014213 3300009826 Unclassified 12435
39 Ga0123355_10031758 3300009826 Unclassified 8568
40 Ga0123353_10033378 3300010167 Bacteria 8014
41 Ga0123353_10134245 3300010167 Unclassified 3970
42 Ga0123353_10444674 3300010167 Bacteria 1911
43 Ga0123353_10447995 3300010167 Bacteria 1902
44 Ga0466707_318547 3300042601 Bacteria 2727
45 Ga0466713_135694 3300042602 Bacteria 11679
46 Ga0466717_055277 3300042604 Bacteria 1140
47 Ga0466722_017663 3300042609 Bacteria 3937
48 Ga0466722_060541 3300042609 Bacteria 3019
49 Ga0466697_192943 3300042611 Bacteria 2560
50 Ga0562374_0568 3300057007 Bacteria 59172
51 IMNBL1DRAFT_c0010389 3300000062 Bacteria 4464
52 JGI24703J35330_11732838 3300002501 Bacteria 2815
53 JGI24703J35330_11745445 3300002501 Bacteria 4593
54 Ga0466727_265395 3300042655 Bacteria 1395
55 Ga0466712_221181 3300042614 Bacteria 28077
56 Ga0466723_091070 3300042618 Bacteria 80773
57 Ga0415639_043799 3300038395 Bacteria 8558
58 Ga0466692_046574 3300042591 Bacteria 14818
59 Ga0466692_191207 3300042591 Unclassified 7719
60 Ga0466696_233238 3300042596 Bacteria 1556
61 Ga0123356_10012351 3300010049 Bacteria 8292
62 Ga0123356_10511735 3300010049 Bacteria 1358
63 Ga0123353_10165298 3300010167 Unclassified 3518
64 Ga0123353_10201478 3300010167 Bacteria 3131
65 Ga0466707_052901 3300042601 Bacteria 24964
66 Ga0466707_233622 3300042601 Bacteria 11636
67 Ga0466707_243590 3300042601 Bacteria 5607
68 Ga0466713_059769 3300042602 Bacteria 172763
69 Ga0562379_0864 3300056790 Bacteria 45677
70 Ga0562377_0264 3300056842 Bacteria 116515
71 Ga0562375_0013 3300056856 Bacteria 1229523
72 Ga0562374_0008 3300057007 Bacteria 1999653
73 Ga0072940_1099348 3300005200 Bacteria 7185
74 Ga0466724_56909 3300042649 Bacteria 15742
75 Ga0466712_101966 3300042614 Bacteria 2957
76 Ga0466726_252095 3300042619 Bacteria 6933
77 Ga0466728_001147 3300042620 Bacteria 2698
78 Ga0466696_312354 3300042596 Bacteria 4120
79 Ga0123357_10035602 3300009784 Bacteria 6768
80 Ga0123353_10129141 3300010167 Bacteria 4058
81 Ga0123353_10926471 3300010167 Bacteria 1182
82 Ga0123354_10143987 3300010882 Bacteria 2929
83 Ga0466707_344657 3300042601 Bacteria 6400
84 Ga0466713_026803 3300042602 Bacteria 64874
85 Ga0466719_045714 3300042606 Bacteria 2612
86 Ga0466719_456299 3300042606 Bacteria 2333
87 Ga0466722_246602 3300042609 Bacteria 12685
88 Ga0562377_0882 3300056842 Unclassified 39194
89 JGI24698J34947_10000311 3300002449 Bacteria 21367
90 JGI24698J34947_10005559 3300002449 Unclassified 6915
91 JGI24698J34947_10011833 3300002449 Unclassified 4792
92 JGI24698J34947_10034459 3300002449 Bacteria 2649
93 JGI24700J35501_10930816 3300002508 Bacteria 25448
94 JGI24700J35501_10930817 3300002508 Bacteria 25486
95 CVPL010L_1001570 3300002932 Bacteria 3609
96 Ga0072941_1002644 3300005201 Bacteria 83076
97 Ga0466734_160894 3300042623 Bacteria 1334
98 Ga0466734_165511 3300042623 Bacteria 1189
99 Ga0466730_024608 3300042625 Unclassified 6883
100 Ga0466711_406868 3300042615 Bacteria 4072
101 Ga0466715_146475 3300042616 Bacteria 8599
102 Ga0466715_418785 3300042616 Bacteria 3278
103 Ga0466726_037128 3300042619 Bacteria 7242
104 Ga0415639_002705 3300038395 Bacteria 45823
105 Ga0415639_185778 3300038395 Bacteria 2901
106 Ga0466694_205019 3300042594 Bacteria 3232
107 Ga0123357_10153687 3300009784 Bacteria 2783
108 Ga0123355_10004025 3300009826 Bacteria 21295
109 Ga0123355_10088251 3300009826 Bacteria 4927
110 Ga0123356_10047255 3300010049 Bacteria 4004
111 Ga0123356_10122078 3300010049 Bacteria 2536
112 Ga0123356_10154554 3300010049 Bacteria 2283
113 Ga0123353_10005780 3300010167 Bacteria 16326
114 Ga0123353_10086059 3300010167 Bacteria 5062
115 Ga0123353_10121090 3300010167 Bacteria 4208
116 Ga0123354_10023525 3300010882 Bacteria 9714
117 Ga0123354_10046303 3300010882 Bacteria 6646
118 Ga0123354_10118954 3300010882 Bacteria 3426
119 Ga0123354_10129766 3300010882 Bacteria 3191
120 Ga0466700_414066 3300042600 Bacteria 3209
121 Ga0466707_106253 3300042601 Bacteria 108878
122 Ga0466707_172858 3300042601 Bacteria 9195
123 Ga0466707_233573 3300042601 Unclassified 2266
124 Ga0466733_062564 3300042659 Bacteria 17813
125 Ga0466733_120672 3300042659 Bacteria 26705
126 Ga0562377_0019 3300056842 Bacteria 1067000
127 JGI24696J40584_12959644 3300002834 Bacteria 5412
128 Ga0072941_1059063 3300005201 Bacteria 39555
129 Ga0466735_192787 3300042624 Bacteria 4212
130 Ga0466703_266629 3300042636 Bacteria 2184
131 Ga0466704_128930 3300042643 Bacteria 11229
132 Ga0466704_504111 3300042643 Bacteria 7744
133 Ga0466708_295249 3300042652 Bacteria 14129
134 Ga0466712_009968 3300042614 Bacteria 14444
135 Ga0466712_113890 3300042614 Bacteria 23988
136 Ga0466726_052608 3300042619 Bacteria 4820
137 Ga0466693_194138 3300042592 Bacteria 3782
138 Ga0466696_010017 3300042596 Bacteria 6157
139 Ga0123355_10045932 3300009826 Unclassified 7104
140 Ga0123355_10138664 3300009826 Bacteria 3729
141 Ga0123356_10013031 3300010049 Bacteria 8043
142 Ga0123354_10177455 3300010882 Bacteria 2448
143 Ga0466707_011603 3300042601 Bacteria 2904
144 Ga0466707_154618 3300042601 Bacteria 8330
145 Ga0466697_280414 3300042611 Bacteria 4429
146 Ga0466733_101104 3300042659 Bacteria 1324
147 Ga0530661_000258 3300056564 Bacteria 42354
148 Ga0562379_0005 3300056790 Bacteria 2649770
149 Ga0562379_0363 3300056790 Bacteria 104557
150 Ga0562377_0063 3300056842 Bacteria 461046
151 Ga0562375_0009 3300056856 Bacteria 1746158
152 Ga0562375_0096 3300056856 Bacteria 273717
153 Ga0562374_0006 3300057007 Bacteria 2178283
154 JGI24695J34938_10069575 3300002450 Unclassified 1475
155 JGI24703J35330_11746237 3300002501 Bacteria 5088
156 Ga0105553_1088541 3300007767 Unclassified 3007
157 Ga0466734_019526 3300042623 Bacteria 2273
158 Ga0466727_045726 3300042655 Bacteria 10597
159 Ga0466715_067285 3300042616 Bacteria 27295
160 Ga0466715_547364 3300042616 Bacteria 11495
161 Ga0466715_631008 3300042616 Bacteria 2889
162 Ga0466726_485267 3300042619 Bacteria 1522
163 Ga0415639_208694 3300038395 Bacteria 3844
164 Ga0466656_324624 3300042550 Bacteria 1013
165 Ga0466696_114898 3300042596 Bacteria 1488
166 Ga0123355_10038641 3300009826 Bacteria 7763
167 Ga0123355_10395654 3300009826 Bacteria 1787
168 Ga0123356_10016162 3300010049 Bacteria 7128
169 Ga0123356_10018538 3300010049 Unclassified 6605
170 Ga0123353_10074706 3300010167 Bacteria 5448
171 Ga0123353_10804060 3300010167 Bacteria 1298
172 Ga0123353_10959585 3300010167 Bacteria 1155
173 Ga0466701_051645 3300042598 Bacteria 1644
174 Ga0466707_224672 3300042601 Bacteria 2261
175 Ga0466722_086033 3300042609 Bacteria 2197
176 Ga0466705_197008 3300042612 Bacteria 18545
177 Ga0466705_364507 3300042612 Bacteria 1423
178 Ga0562379_0231 3300056790 Bacteria 152000
179 2227090010 2225789004 Bacteria 1839
180 2227150830 2225789004 Bacteria 1588
181 JGI24698J34947_10000844 3300002449 Bacteria 15391
182 Ga0466734_161874 3300042623 Bacteria 2573
183 Ga0466712_072724 3300042614 Unclassified 6369
184 Ga0466715_097016 3300042616 Bacteria 22103
185 Ga0466694_222635 3300042594 Unclassified 1701
186 Ga0466696_365644 3300042596 Bacteria 2105
187 Ga0123357_10015989 3300009784 Bacteria 9857
188 Ga0123357_10031484 3300009784 Unclassified 7196
189 Ga0123355_10039985 3300009826 Bacteria 7633
190 Ga0123355_10080377 3300009826 Bacteria 5205
191 Ga0123356_10039591 3300010049 Bacteria 4391
192 Ga0123353_10305520 3300010167 Bacteria 2425
193 Ga0123353_10307384 3300010167 Bacteria 2416
194 Ga0123353_10915876 3300010167 Bacteria 1191
195 Ga0123354_10280901 3300010882 Bacteria 1617
196 Ga0466700_125904 3300042600 Bacteria 18922
197 Ga0466707_083766 3300042601 Bacteria 14435
198 Ga0466707_181727 3300042601 Bacteria 103366
199 Ga0466707_359476 3300042601 Bacteria 5626
200 Ga0466714_064292 3300042603 Bacteria 74164
201 Ga0466719_155889 3300042606 Bacteria 6002

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10031484 Ga0123357_100314845 263
2 3300042612 Ga0466705_364507 Ga0466705_364507_601_1410 269
3 iso_pr_bacteria 2820357977 2820359998 281
4 3300042550 Ga0466656_324624 Ga0466656_324624_144_998 284
5 3300042618 Ga0466723_091070 Ga0466723_091070_24517_25446 286
6 3300042601 Ga0466707_106253 Ga0466707_106253_33466_34380 287
7 3300010167 Ga0123353_10160117 Ga0123353_101601174 288
8 3300042619 Ga0466726_485267 Ga0466726_485267_545_1477 288
9 3300042611 Ga0466697_280414 Ga0466697_280414_50_922 290
10 3300042596 Ga0466696_312354 Ga0466696_312354_32_910 292
11 iso_pr_bacteria 2537562000 2539434015 294
12 iso_pr_bacteria 2563367190 2565787012 294
13 iso_pr_bacteria 2820301196 2820302144 294
14 iso_pr_bacteria 2822232166 2822235895 294
15 iso_pr_bacteria 2864782175 2864783946 294
16 iso_pr_bacteria 2912849059 2912853700 294
17 iso_pr_bacteria 2916873227 2916879443 294
18 iso_pr_bacteria 2969145278 2969149050 294
19 iso_pr_bacteria 2978778678 2978782223 294
20 iso_pr_bacteria 643886085 644681887 294
21 iso_pr_bacteria 643886091 644650573 294
22 iso_pr_bacteria 8022725327 8022727086 294
23 iso_pr_bacteria 8022781829 8022783584 294
24 iso_pr_bacteria 8061039349 8061044766 294
25 iso_pr_bacteria 8061045771 8061049557 294
26 iso_pr_bacteria 8061100935 8061104871 294
27 3300002501 JGI24703J35330_11732838 JGI24703J35330_117328382 295
28 3300002501 JGI24703J35330_11745445 JGI24703J35330_117454454 295
29 3300002501 JGI24703J35330_11746237 JGI24703J35330_117462373 295
30 3300002501 JGI24703J35330_11747588 JGI24703J35330_117475886 295
31 3300002507 JGI24697J35500_11273298 JGI24697J35500_112732982 295
32 3300002508 JGI24700J35501_10849990 JGI24700J35501_108499901 295
33 3300002508 JGI24700J35501_10930817 JGI24700J35501_1093081713 295
34 3300005201 Ga0072941_1059063 Ga0072941_105906314 295
35 3300009826 Ga0123355_10004025 Ga0123355_1000402514 295
36 3300009826 Ga0123355_10038641 Ga0123355_100386416 295
37 3300009826 Ga0123355_10039985 Ga0123355_100399855 295
38 3300009826 Ga0123355_10098550 Ga0123355_100985503 295
39 3300009826 Ga0123355_10138664 Ga0123355_101386645 295
40 3300009826 Ga0123355_10031758 Ga0123355_100317582 296
41 3300009826 Ga0123355_10395654 Ga0123355_103956542 296
42 iso_pr_bacteria 2820693137 2820695266 296
43 3300002450 JGI24695J34938_10069575 JGI24695J34938_100695752 297
44 3300042596 Ga0466696_365644 Ga0466696_365644_289_1257 297
45 2225789004 2227090010 2227468634 298
46 3300042616 Ga0466715_097016 Ga0466715_097016_5778_6674 298
47 iso_pr_bacteria 2645727721 2646683575 298
48 iso_pr_bacteria 2684622911 2686072807 298
49 iso_pr_bacteria 2684622912 2686074707 298
50 iso_pr_bacteria 2684622913 2686076319 298
51 iso_pr_bacteria 2758568511 2760261259 298
52 iso_pr_bacteria 2758568513 2760264804 298
53 iso_pr_bacteria 2758568514 2760266681 298
54 iso_pr_bacteria 2758568515 2760268736 298
55 iso_pr_bacteria 2758568558 2760423564 298
56 iso_pr_bacteria 2758568559 2760425915 298
57 iso_pr_bacteria 2758568560 2760427847 298
58 iso_pr_bacteria 2758568561 2760428997 298
59 iso_pr_bacteria 2808606958 2811757595 298
60 iso_pr_bacteria 2877513988 2877514046 298
61 iso_pr_bacteria 2896843662 2896846112 298
62 iso_pr_bacteria 2912324399 2912324441 298
63 iso_pr_bacteria 2961515617 2961515689 298
64 iso_pr_bacteria 2979949929 2979949991 298
65 iso_pr_bacteria 3004719924 3004721428 298
66 iso_pr_bacteria 8017462664 8017462741 298
67 iso_pr_bacteria 8017489919 8017490620 298
68 iso_pr_bacteria 8017536074 8017536132 298
69 3300002834 JGI24696J40584_12959644 JGI24696J40584_129596446 299
70 3300009784 Ga0123357_10090522 Ga0123357_100905222 299
71 3300041968 Ga0456237_0003896 Ga0456237_0003896_1295_2194 299
72 3300042591 Ga0466692_191207 Ga0466692_191207_5360_6259 299
73 3300042623 Ga0466734_160894 Ga0466734_160894_128_1027 299
74 3300056790 Ga0562379_0005 Ga0562379_0005_1468215_1469114 299
75 3300056790 Ga0562379_0035 Ga0562379_0035_429996_430895 299
76 3300056790 Ga0562379_0073 Ga0562379_0073_261616_262515 299
77 3300056790 Ga0562379_0231 Ga0562379_0231_32136_33035 299
78 3300056790 Ga0562379_0363 Ga0562379_0363_44704_45603 299
79 3300056790 Ga0562379_0745 Ga0562379_0745_2635_3534 299
80 3300056790 Ga0562379_0864 Ga0562379_0864_3219_4118 299
81 3300056842 Ga0562377_0019 Ga0562377_0019_643730_644629 299
82 3300056842 Ga0562377_0063 Ga0562377_0063_129335_130234 299
83 3300056842 Ga0562377_0264 Ga0562377_0264_35726_36625 299
84 3300056842 Ga0562377_0882 Ga0562377_0882_12352_13251 299
85 3300056856 Ga0562375_0005 Ga0562375_0005_1536104_1537003 299
86 3300056856 Ga0562375_0009 Ga0562375_0009_1598398_1599297 299
87 3300056856 Ga0562375_0013 Ga0562375_0013_420064_420963 299
88 3300056856 Ga0562375_0096 Ga0562375_0096_49314_50213 299
89 3300056856 Ga0562375_0100 Ga0562375_0100_195651_196550 299
90 3300057007 Ga0562374_0006 Ga0562374_0006_117137_118036 299
91 3300057007 Ga0562374_0008 Ga0562374_0008_109876_110775 299
92 3300057007 Ga0562374_1386 Ga0562374_1386_18776_19675 299
93 iso_pr_bacteria 2576861670 2579167117 299
94 iso_pr_bacteria 2595698190 2596205849 299
95 iso_pr_bacteria 2595698193 2596211257 299
96 iso_pr_bacteria 2595698194 2596213050 299
97 iso_pr_bacteria 2595698195 2596214946 299
98 iso_pr_bacteria 2595698196 2596216760 299
99 iso_pr_bacteria 2595698197 2596218597 299
100 iso_pr_bacteria 2595698198 2596220428 299
101 iso_pr_bacteria 2595698199 2596222240 299
102 iso_pr_bacteria 2597490293 2598964242 299
103 iso_pr_bacteria 2622736579 2623392465 299
104 iso_pr_bacteria 2627853628 2628280623 299
105 iso_pr_bacteria 2690315820 2691200911 299
106 iso_pr_bacteria 2718218475 2721609113 299
107 iso_pr_bacteria 2728369362 2730151987 299
108 iso_pr_bacteria 2740892556 2743947488 299
109 iso_pr_bacteria 2770939318 2771021755 299
110 iso_pr_bacteria 2775507073 2777018416 299
111 iso_pr_bacteria 2825804107 2825804394 299
112 iso_pr_bacteria 2881375749 2881377351 299
113 iso_pr_bacteria 2890957088 2890961178 299
114 iso_pr_bacteria 2937236879 2937239408 299
115 iso_pr_bacteria 2940218408 2940218687 299
116 iso_pr_bacteria 2940261461 2940261737 299
117 iso_pr_bacteria 2957623355 2957623839 299
118 iso_pr_bacteria 2960772748 2960774777 299
119 iso_pr_bacteria 2964739456 2964742546 299
120 iso_pr_bacteria 2964749277 2964750046 299
121 iso_pr_bacteria 2964765680 2964767813 299
122 iso_pr_bacteria 2964775400 2964777863 299
123 iso_pr_bacteria 2964778705 2964780784 299
124 iso_pr_bacteria 2967802344 2967805668 299
125 iso_pr_bacteria 2967825073 2967826029 299
126 iso_pr_bacteria 2970225615 2970228943 299
127 iso_pr_bacteria 2970254690 2970255874 299
128 iso_pr_bacteria 2977592972 2977596069 299
129 iso_pr_bacteria 2977596371 2977599468 299
130 iso_pr_bacteria 2977622177 2977625230 299
131 iso_pr_bacteria 2977628635 2977630793 299
132 iso_pr_bacteria 2977635137 2977638400 299
133 iso_pr_bacteria 2977653127 2977656329 299
134 iso_pr_bacteria 647533136 647748159 299
135 iso_pr_bacteria 650716050 650845220 299
136 iso_pr_bacteria 8002299145 8002300366 299
137 iso_pr_bacteria 8007211731 8007213428 299
138 iso_pr_bacteria 8007215774 8007218486 299
139 iso_pr_bacteria 8007220153 8007222926 299
140 iso_pr_bacteria 8007223943 8007225765 299
141 iso_pr_bacteria 8007237282 8007240605 299
142 iso_pr_bacteria 8012939035 8012939414 299
143 iso_pr_bacteria 8018750880 8018753763 299
144 iso_pr_bacteria 8018754795 8018755993 299
145 iso_pr_bacteria 8018794549 8018797375 299
146 iso_pr_bacteria 8018798118 8018800119 299
147 iso_pr_bacteria 8018802046 8018804924 299
148 iso_pr_bacteria 8038268975 8038271345 299
149 iso_pr_bacteria 8077780672 8077781954 299
150 iso_pr_bacteria 8108568626 8108568799 299
151 iso_pr_bacteria 8108568626 8108570025 299
152 iso_pr_bacteria 8108576847 8108577225 299
153 iso_pr_bacteria 8114537524 8114538218 299
154 iso_pr_bacteria 8114541043 8114541576 299
155 iso_pr_bacteria 8114544644 8114544852 299
156 iso_pr_bacteria 8114549044 8114549422 299
157 iso_pr_bacteria 8114555646 8114555819 299
158 iso_pr_bacteria 8114555646 8114557045 299
159 3300002932 CVPL010L_1001570 CVPL010L_10015703 300
160 3300007767 Ga0105553_1088541 Ga0105553_10885412 300
161 3300042601 Ga0466707_120204 Ga0466707_120204_6458_7360 300
162 3300042609 Ga0466722_017663 Ga0466722_017663_2400_3302 300
163 3300042611 Ga0466697_192943 Ga0466697_192943_1107_2009 300
164 3300042649 Ga0466724_56909 Ga0466724_56909_4661_5563 300
165 iso_pr_bacteria 2873581347 2873582982 300
166 3300002449 JGI24698J34947_10012730 JGI24698J34947_100127303 301
167 3300042600 Ga0466700_125904 Ga0466700_125904_16613_17518 301
168 3300042614 Ga0466712_009968 Ga0466712_009968_5031_5936 301
169 3300042614 Ga0466712_072724 Ga0466712_072724_2807_3712 301
170 3300042614 Ga0466712_101966 Ga0466712_101966_533_1438 301
171 3300042614 Ga0466712_113890 Ga0466712_113890_2038_2943 301
172 3300042614 Ga0466712_221181 Ga0466712_221181_7478_8383 301
173 3300042624 Ga0466735_192787 Ga0466735_192787_28_933 301
174 iso_pr_bacteria 2524614537 2524834349 301
175 iso_pr_bacteria 2585428141 2588055477 301
176 iso_pr_bacteria 2751185832 2753510822 301
177 iso_pr_bacteria 2820406809 2820408724 301
178 iso_pr_bacteria 2843246524 2843249484 301
179 iso_pr_bacteria 2852123468 2852124049 301
180 iso_pr_bacteria 2855361764 2855365360 301
181 iso_pr_bacteria 2873593402 2873594049 301
182 iso_pr_bacteria 2873597894 2873599088 301
183 iso_pr_bacteria 2923762712 2923763142 301
184 iso_pr_bacteria 2936628749 2936629936 301
185 iso_pr_bacteria 8066790652 8066792323 301
186 iso_pr_bacteria 8066792404 8066793834 301
187 iso_pr_bacteria 8066794103 8066794447 301
188 iso_pr_bacteria 8066795793 8066797510 301
189 iso_pr_bacteria 8066797744 8066799173 301
190 iso_pr_bacteria 8066799369 8066800766 301
191 iso_pr_bacteria 8066802609 8066804098 301
192 3300002449 JGI24698J34947_10000311 JGI24698J34947_100003116 302
193 3300002449 JGI24698J34947_10000844 JGI24698J34947_100008443 302
194 3300002449 JGI24698J34947_10000892 JGI24698J34947_100008929 302
195 3300002449 JGI24698J34947_10005559 JGI24698J34947_100055593 302
196 3300002449 JGI24698J34947_10011833 JGI24698J34947_100118333 302
197 3300002449 JGI24698J34947_10034459 JGI24698J34947_100344593 302
198 3300002449 JGI24698J34947_10052395 JGI24698J34947_100523951 302
199 3300010167 Ga0123353_10129141 Ga0123353_101291413 302
200 3300010882 Ga0123354_10023525 Ga0123354_1002352510 302
201 3300038395 Ga0415639_043799 Ga0415639_043799_7128_8036 302
202 3300042624 Ga0466735_013597 Ga0466735_013597_50377_51285 302
203 iso_pr_bacteria 2820290662 2820290913 302
204 3300042601 Ga0466707_344657 Ga0466707_344657_961_1872 303
205 3300042625 Ga0466730_024608 Ga0466730_024608_5616_6527 303
206 3300056564 Ga0530661_000258 Ga0530661_000258_14539_15450 303
207 iso_pr_bacteria 2820644600 2820646511 303
208 3300005201 Ga0072941_1002644 Ga0072941_100264414 304
209 3300010167 Ga0123353_10915876 Ga0123353_109158762 304
210 3300010882 Ga0123354_10129766 Ga0123354_101297663 304
211 3300042591 Ga0466692_131728 Ga0466692_131728_12405_13433 304
212 iso_pr_bacteria 2820733257 2820733887 304
213 iso_pr_bacteria 2828301124 2828301314 304
214 iso_pr_bacteria 8064531044 8064531562 304
215 3300010049 Ga0123356_10016974 Ga0123356_100169742 305
216 3300010167 Ga0123353_10086059 Ga0123353_100860592 305
217 3300042601 Ga0466707_052901 Ga0466707_052901_20545_21510 305
218 3300042601 Ga0466707_154618 Ga0466707_154618_4315_5232 305
219 3300042601 Ga0466707_233573 Ga0466707_233573_735_1652 305
220 3300042619 Ga0466726_052608 Ga0466726_052608_3838_4755 305
221 3300042659 Ga0466733_120672 Ga0466733_120672_13835_14752 305
222 iso_pr_bacteria 2619619079 2620606280 305
223 3300038395 Ga0415639_002705 Ga0415639_002705_17922_18842 306
224 3300038395 Ga0415639_208694 Ga0415639_208694_2056_2976 306
225 3300042609 Ga0466722_246602 Ga0466722_246602_5149_6069 306
226 3300042616 Ga0466715_418785 Ga0466715_418785_639_1559 306
227 iso_pr_bacteria 2820309449 2820311134 306
228 iso_pr_bacteria 2820602899 2820603069 306
229 3300002508 JGI24700J35501_10930816 JGI24700J35501_1093081619 307
230 3300009826 Ga0123355_10000621 Ga0123355_1000062129 307
231 3300042659 Ga0466733_062564 Ga0466733_062564_15879_16802 307
232 3300009826 Ga0123355_10014213 Ga0123355_100142136 308
233 3300009826 Ga0123355_10080377 Ga0123355_100803772 308
234 3300010049 Ga0123356_10122078 Ga0123356_101220782 308
235 3300010167 Ga0123353_10444674 Ga0123353_104446742 308
236 3300010167 Ga0123353_10926471 Ga0123353_109264712 308
237 3300042611 Ga0466697_145326 Ga0466697_145326_1251_2270 308
238 iso_pr_bacteria 2864955722 2864959963 308
239 iso_pr_bacteria 643886087 644669507 308
240 iso_pr_bacteria 643886090 644663451 308
241 2225789004 2227150830 2227556628 309
242 3300005200 Ga0072940_1099348 Ga0072940_10993484 309
243 3300010882 Ga0123354_10046303 Ga0123354_100463033 309
244 3300042596 Ga0466696_233238 Ga0466696_233238_445_1374 309
245 3300056564 Ga0530661_042219 Ga0530661_042219_379_1308 309
246 iso_pr_bacteria 2820596822 2820598410 309
247 iso_pr_bacteria 2820734335 2820735353 309
248 3300009826 Ga0123355_10045932 Ga0123355_100459322 310
249 3300010167 Ga0123353_10005780 Ga0123353_100057804 310
250 3300009826 Ga0123355_10088251 Ga0123355_100882514 311
251 3300010167 Ga0123353_10959585 Ga0123353_109595852 311
252 iso_pr_bacteria 2820501819 2820504035 311
253 3300010167 Ga0123353_10447995 Ga0123353_104479952 312
254 3300042592 Ga0466693_194138 Ga0466693_194138_46_984 312
255 3300042594 Ga0466694_205019 Ga0466694_205019_325_1263 312
256 3300042601 Ga0466707_083766 Ga0466707_083766_9621_10580 312
257 3300042603 Ga0466714_064292 Ga0466714_064292_36017_36955 312
258 3300000062 IMNBL1DRAFT_c0010389 IMNBL1DRAFT_00103893 313
259 3300002462 JGI24702J35022_10126241 JGI24702J35022_101262412 313
260 3300010882 Ga0123354_10280901 Ga0123354_102809012 313
261 3300042602 Ga0466713_059769 Ga0466713_059769_132127_133068 313
262 3300042616 Ga0466715_226389 Ga0466715_226389_15857_16798 313
263 3300042616 Ga0466715_547364 Ga0466715_547364_3604_4545 313
264 3300042659 Ga0466733_101104 Ga0466733_101104_83_1024 313
265 3300042601 Ga0466707_318547 Ga0466707_318547_1368_2357 314
266 3300042606 Ga0466719_456299 Ga0466719_456299_402_1508 314
267 3300042616 Ga0466715_067285 Ga0466715_067285_9288_10235 315
268 3300042619 Ga0466726_037128 Ga0466726_037128_4747_5694 315
269 3300010049 Ga0123356_10511735 Ga0123356_105117352 316
270 3300042596 Ga0466696_114898 Ga0466696_114898_271_1221 316
271 3300042636 Ga0466703_266629 Ga0466703_266629_1156_2172 316
272 3300057007 Ga0562374_0568 Ga0562374_0568_19332_20282 316
273 3300042655 Ga0466727_045726 Ga0466727_045726_3310_4473 317
274 iso_pr_bacteria 2820516196 2820517557 317
275 3300042604 Ga0466717_055277 Ga0466717_055277_94_1050 318
276 iso_pr_bacteria 2820626145 2820626616 318
277 iso_pr_bacteria 2820950349 2820951043 320
278 3300010167 Ga0123353_10033378 Ga0123353_100333783 321
279 3300042602 Ga0466713_135694 Ga0466713_135694_5623_6645 321
280 3300042615 Ga0466711_406868 Ga0466711_406868_1498_2535 321
281 2225789004 2227494095 2227969635 322
282 3300010049 Ga0123356_10154554 Ga0123356_101545542 322
283 3300010882 Ga0123354_10118954 Ga0123354_101189541 322
284 3300042600 Ga0466700_414066 Ga0466700_414066_174_1142 322
285 3300042621 Ga0466729_316237 Ga0466729_316237_7851_8819 322
286 3300042623 Ga0466734_019526 Ga0466734_019526_645_1613 322
287 3300042623 Ga0466734_161874 Ga0466734_161874_978_1946 322
288 3300042655 Ga0466727_265395 Ga0466727_265395_146_1282 322
289 3300010882 Ga0123354_10143987 Ga0123354_101439872 323
290 3300042591 Ga0466692_046574 Ga0466692_046574_2990_4009 323
291 3300042623 Ga0466734_006750 Ga0466734_006750_3201_4172 323
292 3300010049 Ga0123356_10047255 Ga0123356_100472551 324
293 3300042601 Ga0466707_011603 Ga0466707_011603_1311_2360 324
294 3300042596 Ga0466696_286602 Ga0466696_286602_1238_2272 325
295 3300002462 JGI24702J35022_10100723 JGI24702J35022_101007232 326
296 3300042594 Ga0466694_222635 Ga0466694_222635_709_1689 326
297 3300042602 Ga0466713_026803 Ga0466713_026803_44974_45954 326
298 3300042617 Ga0466718_020487 Ga0466718_020487_70_1050 326
299 3300042643 Ga0466704_128930 Ga0466704_128930_10131_11219 326
300 3300042601 Ga0466707_065903 Ga0466707_065903_689_1672 327
301 3300042620 Ga0466728_178759 Ga0466728_178759_4198_5214 327
302 3300042643 Ga0466704_504111 Ga0466704_504111_198_1292 329
303 3300042652 Ga0466708_114903 Ga0466708_114903_41102_42109 329
304 3300042601 Ga0466707_172858 Ga0466707_172858_5498_6490 330
305 3300042601 Ga0466707_243590 Ga0466707_243590_2144_3136 330
306 3300042601 Ga0466707_359476 Ga0466707_359476_2353_3345 330
307 3300042616 Ga0466715_146475 Ga0466715_146475_2792_3889 330
308 3300042636 Ga0466703_117476 Ga0466703_117476_1424_2416 330
309 3300010049 Ga0123356_10018538 Ga0123356_100185382 331
310 3300010167 Ga0123353_10307384 Ga0123353_103073842 331
311 3300009784 Ga0123357_10035602 Ga0123357_100356023 332
312 3300010049 Ga0123356_10013031 Ga0123356_100130314 332
313 3300010049 Ga0123356_10039591 Ga0123356_100395914 332
314 3300042609 Ga0466722_086033 Ga0466722_086033_137_1135 332
315 3300042601 Ga0466707_233622 Ga0466707_233622_6424_7425 333
316 3300042609 Ga0466722_060541 Ga0466722_060541_323_1324 333
317 3300042619 Ga0466726_252095 Ga0466726_252095_2605_3636 333
318 3300010167 Ga0123353_10121090 Ga0123353_101210905 334
319 3300038395 Ga0415639_185778 Ga0415639_185778_1286_2290 334
320 3300042601 Ga0466707_181727 Ga0466707_181727_6942_7952 336
321 3300042601 Ga0466707_224672 Ga0466707_224672_1240_2250 336
322 3300010049 Ga0123356_10016162 Ga0123356_100161622 337
323 3300010882 Ga0123354_10177455 Ga0123354_101774552 337
324 3300042606 Ga0466719_045714 Ga0466719_045714_613_1692 337
325 3300010049 Ga0123356_10012351 Ga0123356_100123514 339
326 3300010167 Ga0123353_10134245 Ga0123353_101342453 339
327 3300010167 Ga0123353_10165298 Ga0123353_101652982 339
328 3300010167 Ga0123353_10305520 Ga0123353_103055202 339
329 3300010167 Ga0123353_10804060 Ga0123353_108040601 339
330 3300042620 Ga0466728_001147 Ga0466728_001147_1022_2041 339
331 3300010167 Ga0123353_10074706 Ga0123353_100747062 342
332 3300010167 Ga0123353_10201478 Ga0123353_102014783 342
333 3300042652 Ga0466708_295249 Ga0466708_295249_8052_9146 345
334 3300042606 Ga0466719_155889 Ga0466719_155889_1853_2893 346
335 3300009784 Ga0123357_10153687 Ga0123357_101536872 347
336 3300042612 Ga0466705_197008 Ga0466705_197008_15215_16258 347
337 3300042636 Ga0466703_038561 Ga0466703_038561_228_1271 347
338 3300042623 Ga0466734_165511 Ga0466734_165511_32_1078 348
339 3300042596 Ga0466696_010017 Ga0466696_010017_1788_2855 355
340 3300042643 Ga0466704_004753 Ga0466704_004753_13578_14750 355
341 3300042598 Ga0466701_051645 Ga0466701_051645_355_1437 360
342 3300009784 Ga0123357_10015989 Ga0123357_100159893 363
343 3300042616 Ga0466715_631008 Ga0466715_631008_85_1212 375

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 82 221 0.97
PF13732 DUF4162 Domain of unknown function (DUF4162) 275 365 0.84
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 177 252 0.84

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.