Protein Family IF07846

Metagenome Metatranscriptome Isolate
207 Members
132 Samples
137 Scaffolds
242.67 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_603110|Ga0466715_603110_976_1827
Length
283 aa
Sequence
MSYFLKKRGKNPKDLKRKLYLREVCNSTMRSIETRKFKFEGRTTMNLEGKTAVISGGARGLGEAMAKLFAEKGARVIACDMGDPQQSYANVEFYKLNVTDVEACGKFFSYAVEKYKKIDILVNNAGITRDGMTRKMTDEMWNLVIDVNLKGVFNLTRLIGPHMEDTGGGSIVNISSIVGEYGNIGQINYAASKAGVIGMSKTWAKEFARKGVPVRCNAIAPGYIMTDILKTVPQELLDKFAASTMLGRLGQPEEIAKVALFLASDDASYVTGTVISANGGMRL

📊 Sample Types

Isolate 33.8%
Metagenome 61.4%
MAG 0.0%
Metatranscriptome 4.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.2%
Termitidae 18.3%
Apidae 13.5%
Kalotermitidae 9.5%
Tenebrionidae 7.9%
Ixodidae 4.8%
Blattidae 4.0%
Termopsidae 2.4%
Chrysomelidae 2.4%
Formicidae 2.4%
Armadillidiidae 2.4%
Rhinotermitidae 1.6%
Hodotermitidae 0.8%
Elmidae 0.8%
Curculionidae 0.8%
Scarabaeidae 0.8%
Drosophilidae 0.8%
Culicidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 194
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
4 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
5 2548876780 Rickettsia sibirica BJ-90 Isolate Ixodidae
6 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
7 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300060704 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
11 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
12 8068946563 Bartonella apihabitans M0187 Isolate Apidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
15 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
24 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
25 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
26 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300060700 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
29 3300060707 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
30 3300060751 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
31 8073624232 Bartonella sp. W8151 Isolate Apidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2751185858 Bartonella apis BBC0122 Isolate Apidae
38 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300060756 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
41 3300060770 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
42 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
43 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
44 8073619611 Bartonella apis B10834G6 Isolate Apidae
45 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
46 2998834370 Enterobacteriaceae endosymbiont of Plateumaris consimilis PconSym Isolate Chrysomelidae
47 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
48 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
49 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
56 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
57 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
58 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
59 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
60 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
61 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
62 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
63 3300061798 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
64 8068950955 Bartonella apihabitans W8097 Isolate Apidae
65 8073621894 Bartonella apis W8099 Isolate Apidae
66 647533204 Rickettsia endosymbiont of Ixodes scapularis Isolate Ixodidae
67 2998827396 Enterobacteriaceae endosymbiont of Plateumaris braccata PbraSym Isolate Chrysomelidae
68 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
69 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
70 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
71 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
72 2751185856 Bartonella apis BBC0244 Isolate Apidae
73 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
74 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
75 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
76 2582581025 Rickettsia tamurae buchneri ISO7 Isolate Ixodidae
77 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
78 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
79 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
80 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
81 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
82 8073544309 Actinomadura sp. RB99 Isolate Termitidae
83 8073617375 Bartonella apis W8098 Isolate Apidae
84 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
85 644736402 Rickettsia africae ESF-5 Isolate Ixodidae
86 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
87 2751185853 Bartonella apis BBC0178 Isolate Apidae
88 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
89 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
90 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
91 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
92 2834762790 Rickettsia fournieri AUS118 Isolate Unclassified
93 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
94 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
95 3300060752 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
96 8068944069 Bartonella choladocola W8125 Isolate Apidae
97 8068955631 Bartonella apihabitans M0280 Isolate Apidae
98 8073628750 Bartonella sp. W8167 Isolate Apidae
99 638341178 Rickettsia sibirica 246 Isolate Unclassified
100 2998832964 Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym Isolate Chrysomelidae
101 3006667155 Streptomyces sp. SID9727 Isolate
102 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
103 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
104 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
105 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
106 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
107 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
108 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
109 3300060759 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
110 649633028 Candidatus Blochmannia vafer BVAF Isolate Formicidae
111 8068953321 Bartonella apihabitans M0190 Isolate Apidae
112 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
113 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
114 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
115 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
116 2811995359 Rickettsia bellii An04 Isolate Ixodidae
117 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
118 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
119 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
120 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
121 8073626464 Bartonella apis W8152 Isolate Apidae
122 640753044 Rickettsia bellii OSU 85-389 Isolate Ixodidae
123 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
124 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
125 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
126 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
127 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
128 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
129 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
130 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
131 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
132 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_208486 3300042612 Bacteria 71494
2 Ga0590776_00425 3300060759 Unclassified 4690
3 Ga0466692_151188 3300042591 Bacteria 1656
4 Ga0123353_10805913 3300010167 Bacteria 1296
5 Ga0466700_359380 3300042600 Bacteria 2365
6 Ga0466722_100908 3300042609 Bacteria 1804
7 Ga0466722_103405 3300042609 Bacteria 12737
8 Ga0466722_117124 3300042609 Bacteria 1641
9 Ga0466730_071217 3300042625 Bacteria 1174
10 Ga0466727_325530 3300042655 Bacteria 1875
11 WW0001_100148 3300002732 Bacteria 7473
12 Ga0074278_111728 3300005721 Bacteria 3361
13 Ga0466705_348205 3300042612 Bacteria 14127
14 Ga0590807_04206 3300060700 Unclassified 925
15 Ga0160470_100206 3300012813 Bacteria 49427
16 Ga0466690_091502 3300042590 Bacteria 8728
17 Ga0466693_009054 3300042592 Bacteria 2260
18 Ga0466693_267272 3300042592 Bacteria 2626
19 Ga0466691_221500 3300042593 Bacteria 55284
20 Ga0466715_237445 3300042616 Bacteria 1533
21 Ga0466723_244218 3300042618 Bacteria 5803
22 Ga0123355_10002504 3300009826 Bacteria 26043
23 Ga0123353_10080390 3300010167 Bacteria 5242
24 Ga0466719_205774 3300042606 Bacteria 8168
25 Ga0466735_151151 3300042624 Bacteria 2735
26 Ga0466708_139820 3300042652 Unclassified 1285
27 Ga0466708_319318 3300042652 Bacteria 1612
28 JGI24702J35022_10017940 3300002462 Bacteria 3863
29 JGI24700J35501_10930870 3300002508 Bacteria 30720
30 Ga0068305_10000012 3300005083 Bacteria 51331
31 Ga0160443_101107 3300012848 Bacteria 10859
32 Ga0466694_042659 3300042594 Bacteria 7582
33 Ga0466694_252954 3300042594 Bacteria 25516
34 Ga0466723_011731 3300042618 Bacteria 6661
35 Ga0466726_006761 3300042619 Bacteria 1091
36 Ga0123355_10004281 3300009826 Bacteria 20749
37 Ga0123355_10202805 3300009826 Bacteria 2893
38 Ga0123355_10293895 3300009826 Bacteria 2225
39 Ga0123355_10348213 3300009826 Bacteria 1966
40 Ga0123353_10262690 3300010167 Bacteria 2665
41 Ga0466706_183178 3300042599 Bacteria 15497
42 Ga0466722_186716 3300042609 Bacteria 18186
43 Ga0466704_018089 3300042643 Bacteria 9895
44 Ga0466704_171773 3300042643 Bacteria 12329
45 Ga0466709_004973 3300042648 Bacteria 3832
46 Ga0102734_1000008 3300007129 Bacteria 101019
47 Ga0127656_102602 3300009453 Bacteria 31892
48 Ga0466657_147637 3300042582 Bacteria 1269
49 Ga0466690_012460 3300042590 Bacteria 15225
50 Ga0466692_115206 3300042591 Bacteria 8018
51 Ga0466694_332883 3300042594 Bacteria 1430
52 Ga0466711_305093 3300042615 Bacteria 15838
53 Ga0466718_033109 3300042617 Bacteria 11387
54 Ga0466718_130488 3300042617 Bacteria 3267
55 Ga0466726_140145 3300042619 Bacteria 2760
56 Ga0123357_10153451 3300009784 Bacteria 2786
57 Ga0123355_10017057 3300009826 Bacteria 11464
58 Ga0123355_10107660 3300009826 Bacteria 4366
59 Ga0123355_10125009 3300009826 Bacteria 3977
60 Ga0123355_10458974 3300009826 Bacteria 1600
61 Ga0123353_10017189 3300010167 Bacteria 10614
62 Ga0123353_10123576 3300010167 Bacteria 4160
63 Ga0123353_10858695 3300010167 Bacteria 1243
64 Ga0466700_089307 3300042600 Bacteria 2392
65 Ga0466719_281488 3300042606 Bacteria 1332
66 Ga0466734_129545 3300042623 Bacteria 1670
67 Ga0466709_140130 3300042648 Bacteria 1405
68 Ga0590770_06084 3300061798 Unclassified 907
69 Ga0415639_009990 3300038395 Bacteria 22731
70 Ga0466692_185139 3300042591 Bacteria 5045
71 Ga0466694_408943 3300042594 Bacteria 1365
72 Ga0466712_216378 3300042614 Bacteria 1816
73 Ga0466723_210316 3300042618 Bacteria 3204
74 Ga0123355_10037191 3300009826 Bacteria 7913
75 Ga0466713_005286 3300042602 Bacteria 50542
76 Ga0466713_047897 3300042602 Bacteria 9584
77 Ga0466714_029630 3300042603 Bacteria 5379
78 Ga0466698_267540 3300042610 Bacteria 2011
79 Ga0466698_446219 3300042610 Bacteria 2108
80 Ga0466704_565798 3300042643 Bacteria 22995
81 Ga0466708_061888 3300042652 Bacteria 4354
82 Ga0074278_122003 3300005721 Bacteria 1106
83 Ga0127657_100003 3300009457 Bacteria 550482
84 Ga0123357_10000236 3300009784 Bacteria 52499
85 Ga0466732_147084 3300042656 Unclassified 3174
86 Ga0590766_03054 3300060752 Bacteria 2147
87 Ga0590772_00463 3300060756 Unclassified 4673
88 Ga0590794_00849 3300060770 Unclassified 3334
89 Ga0160444_100035 3300012841 Bacteria 202992
90 Ga0160445_101259 3300012847 Bacteria 7605
91 Ga0466693_062886 3300042592 Bacteria 1490
92 Ga0466693_402515 3300042592 Bacteria 1654
93 Ga0466718_003975 3300042617 Bacteria 9930
94 Ga0466726_303193 3300042619 Bacteria 1159
95 Ga0466728_008248 3300042620 Bacteria 12629
96 Ga0123355_10010947 3300009826 Bacteria 13958
97 Ga0123355_10041971 3300009826 Bacteria 7447
98 Ga0123355_10059152 3300009826 Unclassified 6195
99 Ga0123355_10214534 3300009826 Bacteria 2781
100 Ga0123355_10268149 3300009826 Bacteria 2377
101 Ga0123356_10651881 3300010049 Bacteria 1220
102 Ga0123353_10814501 3300010167 Bacteria 1287
103 Ga0160442_100169 3300012806 Bacteria 59733
104 Ga0466713_112604 3300042602 Bacteria 69095
105 Ga0466713_149396 3300042602 Bacteria 5017
106 Ga0466735_210654 3300042624 Bacteria 1707
107 Ga0466703_011285 3300042636 Bacteria 13510
108 Ga0466708_292976 3300042652 Bacteria 1520
109 JGI24703J35330_11700534 3300002501 Bacteria 2021
110 Ga0590764_05991 3300060751 Unclassified 868
111 Ga0415639_069103 3300038395 Bacteria 3809
112 Ga0466692_200113 3300042591 Bacteria 5542
113 Ga0466715_133762 3300042616 Bacteria 5052
114 Ga0466715_603110 3300042616 Bacteria 2790
115 Ga0466718_110994 3300042617 Unclassified 1356
116 Ga0123355_10362743 3300009826 Bacteria 1907
117 Ga0466735_096797 3300042624 Bacteria 3547
118 Ga0466708_134435 3300042652 Unclassified 1341
119 JGI24695J34938_10015236 3300002450 Bacteria 3950
120 JGI24695J34938_10060620 3300002450 Bacteria 1613
121 JGI24703J35330_11748782 3300002501 Bacteria 35580
122 Ga0074278_126004 3300005721 Bacteria 37893
123 Ga0074278_128945 3300005721 Unclassified 20671
124 Ga0466705_210910 3300042612 Bacteria 10132
125 Ga0590811_02006 3300060704 Bacteria 2170
126 Ga0590816_06967 3300060707 Unclassified 2028
127 Ga0590775_03472 3300060896 Bacteria 2348
128 Ga0264413_145650 3300024493 Bacteria 1814
129 Ga0123355_10269818 3300009826 Bacteria 2366
130 Ga0123355_10430032 3300009826 Bacteria 1680
131 Ga0466706_019380 3300042599 Bacteria 325727
132 Ga0466721_230156 3300042608 Bacteria 21988
133 Ga0466725_081938 3300042654 Bacteria 5640
134 JGI24700J35501_10927909 3300002508 Bacteria 7168
135 JGI24700J35501_10930889 3300002508 Bacteria 34606
136 Ga0068305_10000253 3300005083 Bacteria 49207
137 Ga0074278_115937 3300005721 Bacteria 8469

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2834762790 2834763812 198
2 iso_pr_bacteria 2811995359 2814050603 199
3 iso_pr_bacteria 640753044 640955955 199
4 3300042592 Ga0466693_062886 Ga0466693_062886_13_627 204
5 iso_pr_bacteria 2582581025 2584319359 205
6 iso_pr_bacteria 647533204 647539282 205
7 3300002732 WW0001_100148 WW0001_1001484 212
8 3300042602 Ga0466713_005286 Ga0466713_005286_36787_37527 212
9 3300005083 Ga0068305_10000253 Ga0068305_1000025312 213
10 3300060707 Ga0590816_06967 Ga0590816_06967_1100_1780 226
11 3300042623 Ga0466734_129545 Ga0466734_129545_227_1012 230
12 3300012848 Ga0160443_101107 Ga0160443_1011077 233
13 3300012847 Ga0160445_101259 Ga0160445_1012598 236
14 3300009826 Ga0123355_10348213 Ga0123355_103482131 237
15 3300010049 Ga0123356_10651881 Ga0123356_106518811 237
16 iso_pr_bacteria 2820469612 2820471167 237
17 3300009826 Ga0123355_10430032 Ga0123355_104300322 238
18 3300038395 Ga0415639_009990 Ga0415639_009990_18467_19186 239
19 3300038395 Ga0415639_069103 Ga0415639_069103_2792_3511 239
20 3300042590 Ga0466690_091502 Ga0466690_091502_3411_4130 239
21 3300042591 Ga0466692_151188 Ga0466692_151188_237_956 239
22 3300042591 Ga0466692_185139 Ga0466692_185139_2411_3130 239
23 3300042591 Ga0466692_200113 Ga0466692_200113_242_961 239
24 3300042592 Ga0466693_009054 Ga0466693_009054_733_1452 239
25 3300042592 Ga0466693_267272 Ga0466693_267272_1667_2386 239
26 3300042592 Ga0466693_402515 Ga0466693_402515_911_1630 239
27 3300042594 Ga0466694_042659 Ga0466694_042659_4189_4908 239
28 3300042594 Ga0466694_252954 Ga0466694_252954_13679_14398 239
29 3300042594 Ga0466694_332883 Ga0466694_332883_459_1178 239
30 3300042600 Ga0466700_089307 Ga0466700_089307_1063_1782 239
31 3300042600 Ga0466700_359380 Ga0466700_359380_545_1264 239
32 3300042608 Ga0466721_230156 Ga0466721_230156_13771_14490 239
33 3300042609 Ga0466722_103405 Ga0466722_103405_6643_7362 239
34 3300042609 Ga0466722_117124 Ga0466722_117124_530_1249 239
35 3300042609 Ga0466722_186716 Ga0466722_186716_15415_16134 239
36 3300042610 Ga0466698_267540 Ga0466698_267540_997_1716 239
37 3300042610 Ga0466698_446219 Ga0466698_446219_907_1626 239
38 3300042612 Ga0466705_210910 Ga0466705_210910_5840_6559 239
39 3300042612 Ga0466705_348205 Ga0466705_348205_2269_2988 239
40 3300042615 Ga0466711_305093 Ga0466711_305093_5688_6407 239
41 3300042616 Ga0466715_133762 Ga0466715_133762_1086_1805 239
42 3300042616 Ga0466715_237445 Ga0466715_237445_492_1211 239
43 3300042617 Ga0466718_033109 Ga0466718_033109_569_1288 239
44 3300042617 Ga0466718_110994 Ga0466718_110994_569_1288 239
45 3300042617 Ga0466718_130488 Ga0466718_130488_735_1454 239
46 3300042618 Ga0466723_011731 Ga0466723_011731_176_895 239
47 3300042618 Ga0466723_210316 Ga0466723_210316_458_1177 239
48 3300042619 Ga0466726_006761 Ga0466726_006761_150_869 239
49 3300042619 Ga0466726_140145 Ga0466726_140145_149_868 239
50 3300042643 Ga0466704_018089 Ga0466704_018089_589_1308 239
51 3300042643 Ga0466704_565798 Ga0466704_565798_16993_17712 239
52 3300042648 Ga0466709_004973 Ga0466709_004973_2973_3692 239
53 3300042652 Ga0466708_061888 Ga0466708_061888_889_1608 239
54 3300042652 Ga0466708_134435 Ga0466708_134435_123_842 239
55 3300042652 Ga0466708_139820 Ga0466708_139820_218_937 239
56 3300042652 Ga0466708_292976 Ga0466708_292976_546_1265 239
57 3300042652 Ga0466708_319318 Ga0466708_319318_110_829 239
58 3300042654 Ga0466725_081938 Ga0466725_081938_3890_4609 239
59 3300042656 Ga0466732_147084 Ga0466732_147084_1587_2306 239
60 iso_pr_bacteria 2781125632 2781271957 239
61 iso_pr_bacteria 2781125666 2781343684 239
62 iso_pr_bacteria 2781125692 2781430517 239
63 iso_pr_bacteria 2781125694 2781436436 239
64 iso_pr_bacteria 2781125696 2781441484 239
65 iso_pr_bacteria 2820303403 2820304298 239
66 iso_pr_bacteria 2820309449 2820311443 239
67 iso_pr_bacteria 2820479655 2820481583 239
68 iso_pr_bacteria 2820481688 2820482527 239
69 iso_pr_bacteria 2820499546 2820500523 239
70 iso_pr_bacteria 2820518089 2820519819 239
71 iso_pr_bacteria 2820522177 2820523879 239
72 iso_pr_bacteria 2820537337 2820537774 239
73 iso_pr_bacteria 2820547636 2820548794 239
74 iso_pr_bacteria 2820592308 2820592953 239
75 iso_pr_bacteria 2820598593 2820599561 239
76 iso_pr_bacteria 2820602899 2820604462 239
77 iso_pr_bacteria 2820623020 2820625799 239
78 iso_pr_bacteria 2820627938 2820629800 239
79 iso_pr_bacteria 2820681712 2820682882 239
80 iso_pr_bacteria 2820693137 2820694612 239
81 iso_pr_bacteria 2820709481 2820711474 239
82 iso_pr_bacteria 2820713307 2820713949 239
83 3300002450 JGI24695J34938_10015236 JGI24695J34938_100152364 240
84 3300002450 JGI24695J34938_10060620 JGI24695J34938_100606202 240
85 3300002462 JGI24702J35022_10017940 JGI24702J35022_100179402 240
86 3300002501 JGI24703J35330_11700534 JGI24703J35330_117005342 240
87 3300002501 JGI24703J35330_11748782 JGI24703J35330_1174878239 240
88 3300002508 JGI24700J35501_10927909 JGI24700J35501_109279091 240
89 3300002508 JGI24700J35501_10930870 JGI24700J35501_1093087019 240
90 3300009784 Ga0123357_10000236 Ga0123357_1000023643 240
91 3300009784 Ga0123357_10153451 Ga0123357_101534512 240
92 3300009826 Ga0123355_10002504 Ga0123355_1000250410 240
93 3300009826 Ga0123355_10004281 Ga0123355_1000428113 240
94 3300009826 Ga0123355_10010947 Ga0123355_100109474 240
95 3300009826 Ga0123355_10017057 Ga0123355_100170573 240
96 3300009826 Ga0123355_10037191 Ga0123355_100371912 240
97 3300009826 Ga0123355_10041971 Ga0123355_100419714 240
98 3300009826 Ga0123355_10059152 Ga0123355_100591525 240
99 3300009826 Ga0123355_10107660 Ga0123355_101076604 240
100 3300009826 Ga0123355_10202805 Ga0123355_102028052 240
101 3300009826 Ga0123355_10214534 Ga0123355_102145342 240
102 3300009826 Ga0123355_10268149 Ga0123355_102681493 240
103 3300009826 Ga0123355_10293895 Ga0123355_102938953 240
104 3300009826 Ga0123355_10362743 Ga0123355_103627432 240
105 3300009826 Ga0123355_10458974 Ga0123355_104589741 240
106 3300010167 Ga0123353_10262690 Ga0123353_102626902 240
107 3300010167 Ga0123353_10805913 Ga0123353_108059132 240
108 3300010167 Ga0123353_10814501 Ga0123353_108145011 240
109 3300010167 Ga0123353_10858695 Ga0123353_108586952 240
110 3300042609 Ga0466722_100908 Ga0466722_100908_597_1319 240
111 3300042620 Ga0466728_008248 Ga0466728_008248_4534_5256 240
112 3300042643 Ga0466704_171773 Ga0466704_171773_3054_3776 240
113 3300042648 Ga0466709_140130 Ga0466709_140130_332_1054 240
114 iso_pr_bacteria 2820479655 2820480287 240
115 3300007129 Ga0102734_1000008 Ga0102734_100000884 241
116 3300010167 Ga0123353_10080390 Ga0123353_100803903 241
117 3300012841 Ga0160444_100035 Ga0160444_1000357 241
118 3300042590 Ga0466690_012460 Ga0466690_012460_2976_3701 241
119 3300042593 Ga0466691_221500 Ga0466691_221500_36944_37693 241
120 3300042602 Ga0466713_112604 Ga0466713_112604_16015_16740 241
121 3300042603 Ga0466714_029630 Ga0466714_029630_958_1683 241
122 3300042618 Ga0466723_244218 Ga0466723_244218_1904_2629 241
123 iso_pr_bacteria 2548876780 2549805572 241
124 iso_pr_bacteria 638341178 638412901 241
125 iso_pr_bacteria 644736402 644762729 241
126 3300009453 Ga0127656_102602 Ga0127656_1026024 242
127 3300009457 Ga0127657_100003 Ga0127657_100003243 242
128 3300009826 Ga0123355_10269818 Ga0123355_102698182 242
129 3300010167 Ga0123353_10017189 Ga0123353_100171895 243
130 3300012806 Ga0160442_100169 Ga0160442_10016929 243
131 iso_pr_bacteria 8046957834 8046960791 243
132 3300042655 Ga0466727_325530 Ga0466727_325530_253_987 244
133 iso_pr_bacteria 2834540479 2834541920 244
134 iso_pr_bacteria 649633028 649854692 244
135 3300009826 Ga0123355_10125009 Ga0123355_101250093 245
136 3300042599 Ga0466706_183178 Ga0466706_183178_5188_5925 245
137 3300042636 Ga0466703_011285 Ga0466703_011285_12418_13155 245
138 iso_pr_bacteria 2998827396 2998827488 245
139 iso_pr_bacteria 2998832964 2998833051 245
140 iso_pr_bacteria 2998834370 2998834458 245
141 3300042619 Ga0466726_303193 Ga0466726_303193_72_812 246
142 3300060756 Ga0590772_00463 Ga0590772_00463_98_838 246
143 3300060896 Ga0590775_03472 Ga0590775_03472_156_896 246
144 iso_pr_bacteria 2819994798 2819998077 246
145 3300002508 JGI24700J35501_10930889 JGI24700J35501_1093088914 247
146 3300024493 Ga0264413_145650 Ga0264413_1456503 247
147 3300042591 Ga0466692_115206 Ga0466692_115206_3224_3967 247
148 3300042594 Ga0466694_408943 Ga0466694_408943_502_1245 247
149 3300042599 Ga0466706_019380 Ga0466706_019380_58794_59537 247
150 3300042602 Ga0466713_047897 Ga0466713_047897_6147_6890 247
151 3300042602 Ga0466713_149396 Ga0466713_149396_307_1050 247
152 3300042612 Ga0466705_208486 Ga0466705_208486_31981_32724 247
153 3300042614 Ga0466712_216378 Ga0466712_216378_697_1440 247
154 3300042624 Ga0466735_096797 Ga0466735_096797_342_1085 247
155 3300042624 Ga0466735_151151 Ga0466735_151151_295_1038 247
156 3300042624 Ga0466735_210654 Ga0466735_210654_168_911 247
157 3300005083 Ga0068305_10000012 Ga0068305_1000001215 248
158 3300060770 Ga0590794_00849 Ga0590794_00849_595_1341 248
159 iso_pr_bacteria 2515154100 2515556010 248
160 3300005721 Ga0074278_128945 Ga0074278_12894516 250
161 3300010167 Ga0123353_10123576 Ga0123353_101235762 250
162 3300060700 Ga0590807_04206 Ga0590807_04206_84_842 252
163 3300060751 Ga0590764_05991 Ga0590764_05991_73_831 252
164 3300060759 Ga0590776_00425 Ga0590776_00425_136_894 252
165 3300061798 Ga0590770_06084 Ga0590770_06084_82_840 252
166 iso_pr_bacteria 2852337885 2852341253 252
167 iso_pr_bacteria 2890957088 2890960872 252
168 3300042582 Ga0466657_147637 Ga0466657_147637_220_981 253
169 3300042606 Ga0466719_205774 Ga0466719_205774_563_1324 253
170 3300042625 Ga0466730_071217 Ga0466730_071217_137_898 253
171 3300012813 Ga0160470_100206 Ga0160470_1002067 254
172 3300042606 Ga0466719_281488 Ga0466719_281488_233_997 254
173 3300060704 Ga0590811_02006 Ga0590811_02006_1319_2086 255
174 3300060752 Ga0590766_03054 Ga0590766_03054_63_830 255
175 iso_pr_bacteria 2751185853 2753586482 255
176 iso_pr_bacteria 2751185856 2753591794 255
177 iso_pr_bacteria 2751185858 2753595634 255
178 iso_pr_bacteria 8068941587 8068943003 255
179 iso_pr_bacteria 8068944069 8068945461 255
180 iso_pr_bacteria 8068946563 8068948298 255
181 iso_pr_bacteria 8068950955 8068952772 255
182 iso_pr_bacteria 8068953321 8068954152 255
183 iso_pr_bacteria 8068955631 8068956434 255
184 iso_pr_bacteria 8073617375 8073619155 255
185 iso_pr_bacteria 8073619611 8073620975 255
186 iso_pr_bacteria 8073621894 8073623698 255
187 iso_pr_bacteria 8073624232 8073626011 255
188 iso_pr_bacteria 8073626464 8073627119 255
189 iso_pr_bacteria 8073628750 8073629592 255
190 iso_pr_bacteria 8082291289 8082292200 255
191 3300005721 Ga0074278_111728 Ga0074278_1117282 256
192 3300005721 Ga0074278_115937 Ga0074278_1159372 256
193 3300005721 Ga0074278_122003 Ga0074278_1220032 256
194 3300005721 Ga0074278_126004 Ga0074278_12600414 256
195 iso_pr_bacteria 3006667155 3006674023 257
196 iso_pr_bacteria 8073544309 8073547517 257
197 iso_pr_bacteria 2940380068 2940385957 258
198 iso_pr_bacteria 2940386776 2940392672 258
199 iso_pr_bacteria 2940393498 2940399363 258
200 iso_pr_bacteria 2940400224 2940406151 258
201 iso_pr_bacteria 2940406939 2940412624 258
202 iso_pr_bacteria 2828301124 2828302574 261
203 iso_pr_bacteria 2864955722 2864957843 261
204 iso_pr_bacteria 2821316722 2821317817 263
205 3300042617 Ga0466718_003975 Ga0466718_003975_3536_4333 265
206 iso_pr_bacteria 2990166910 2990172658 266
207 3300042616 Ga0466715_603110 Ga0466715_603110_976_1827 283

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 58 281 0.96
PF00106 adh_short short chain dehydrogenase 50 234 0.95
PF08659 KR KR domain 51 196 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.