Protein Family IF07826
Metagenome
Metatranscriptome
Isolate
163
Members
62
Samples
150
Scaffolds
108.91
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_517576|Ga0466715_517576_5501_5881
- Length
- 126 aa
- Sequence
- MEGKMNTEQIIEAIKGMTILEINDLVKACEEEFGVSAAAPVAVAGAVAPGAAEVEEQTEFTVVLASVGAEKIKVIKVVRELTGLGLKEAKDLVDSAPSNIKENIEKGEAEAVKAQLEGVGASVELK
Sample Types
Isolate
8.0%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Unclassified
20.0%
Kalotermitidae
20.0%
Formicidae
5.0%
Termopsidae
5.0%
Passalidae
3.3%
Hodotermitidae
1.7%
Blattidae
1.7%
Rhinotermitidae
1.7%
Armadillidiidae
1.7%
Taxonomy
Archaea
1
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 2 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 22 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 32 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 33 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 34 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 41 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 54 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 55 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 56 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 57 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 58 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 61 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 62 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_543993 | 3300042616 | Bacteria | 56318 |
| 2 | Ga0466728_171735 | 3300042620 | Bacteria | 1671 |
| 3 | Ga0466734_077527 | 3300042623 | Bacteria | 1086 |
| 4 | Ga0466702_088633 | 3300042635 | Bacteria | 5302 |
| 5 | Ga0255809_1024225 | 3300022820 | Bacteria | 808 |
| 6 | Ga0123357_10022541 | 3300009784 | Bacteria | 8445 |
| 7 | Ga0123355_10528785 | 3300009826 | Bacteria | 1438 |
| 8 | Ga0123356_10335630 | 3300010049 | Unclassified | 1630 |
| 9 | Ga0123356_13125127 | 3300010049 | Bacteria | 577 |
| 10 | Ga0123353_10918563 | 3300010167 | Bacteria | 1189 |
| 11 | Ga0123353_11011878 | 3300010167 | Unclassified | 1115 |
| 12 | Ga0123354_10063581 | 3300010882 | Bacteria | 5422 |
| 13 | 2227247441 | 2225789004 | Bacteria | 32698 |
| 14 | JGI24705J35276_12238059 | 3300002504 | Bacteria | 15438 |
| 15 | Ga0466711_279408 | 3300042615 | Bacteria | 1085 |
| 16 | Ga0466711_358448 | 3300042615 | Unclassified | 1883 |
| 17 | Ga0466702_364574 | 3300042635 | Bacteria | 1709 |
| 18 | Ga0466704_353221 | 3300042643 | Bacteria | 8416 |
| 19 | Ga0466657_140648 | 3300042582 | Bacteria | 1636 |
| 20 | Ga0466694_361185 | 3300042594 | Bacteria | 1574 |
| 21 | Ga0123355_10254905 | 3300009826 | Unclassified | 2464 |
| 22 | Ga0123356_10102286 | 3300010049 | Bacteria | 2750 |
| 23 | Ga0123356_10634717 | 3300010049 | Bacteria | 1234 |
| 24 | Ga0123353_10396830 | 3300010167 | Bacteria | 2055 |
| 25 | Ga0123354_10341080 | 3300010882 | Bacteria | 1350 |
| 26 | Ga0466706_156699 | 3300042599 | Bacteria | 1788 |
| 27 | Ga0466700_143042 | 3300042600 | Bacteria | 2440 |
| 28 | Ga0466714_019741 | 3300042603 | Bacteria | 1049 |
| 29 | Ga0466716_301925 | 3300042605 | Unclassified | 1572 |
| 30 | 2227500465 | 2225789004 | Bacteria | 3816 |
| 31 | 2227646819 | 2225789004 | Bacteria | 44364 |
| 32 | Ga0103268_1001098 | 3300007192 | Bacteria | 7147 |
| 33 | Ga0466697_059308 | 3300042611 | Bacteria | 2580 |
| 34 | Ga0466715_170758 | 3300042616 | Bacteria | 1269 |
| 35 | Ga0466734_151091 | 3300042623 | Bacteria | 4038 |
| 36 | Ga0466702_460447 | 3300042635 | Bacteria | 2280 |
| 37 | Ga0466703_049466 | 3300042636 | Bacteria | 4225 |
| 38 | Ga0466704_111104 | 3300042643 | Bacteria | 16912 |
| 39 | Ga0123356_10668158 | 3300010049 | Bacteria | 1207 |
| 40 | Ga0123356_13197519 | 3300010049 | Unclassified | 570 |
| 41 | Ga0123353_10105806 | 3300010167 | Bacteria | 4534 |
| 42 | Ga0123353_10328469 | 3300010167 | Bacteria | 2317 |
| 43 | Ga0123353_10535217 | 3300010167 | Unclassified | 1695 |
| 44 | Ga0123353_11008427 | 3300010167 | Bacteria | 1118 |
| 45 | Ga0123353_11390700 | 3300010167 | Bacteria | 903 |
| 46 | Ga0123353_11552708 | 3300010167 | Unclassified | 839 |
| 47 | Ga0123353_12590485 | 3300010167 | Bacteria | 600 |
| 48 | Ga0123353_13376065 | 3300010167 | Bacteria | 507 |
| 49 | Ga0123354_10382190 | 3300010882 | Bacteria | 1214 |
| 50 | Ga0466707_389954 | 3300042601 | Bacteria | 4180 |
| 51 | IMNBL1DRAFT_c0000036 | 3300000062 | Bacteria | 120012 |
| 52 | Ga0103264_1000241 | 3300007188 | Bacteria | 33454 |
| 53 | Ga0466697_247968 | 3300042611 | Bacteria | 1218 |
| 54 | Ga0466705_139123 | 3300042612 | Bacteria | 19829 |
| 55 | Ga0466733_079927 | 3300042659 | Bacteria | 4306 |
| 56 | Ga0466715_170123 | 3300042616 | Archaea | 1483 |
| 57 | Ga0466718_089191 | 3300042617 | Bacteria | 1025 |
| 58 | Ga0466723_045605 | 3300042618 | Bacteria | 1693 |
| 59 | Ga0466703_133335 | 3300042636 | Bacteria | 3694 |
| 60 | Ga0466703_216355 | 3300042636 | Bacteria | 4724 |
| 61 | Ga0466708_194360 | 3300042652 | Unclassified | 3691 |
| 62 | Ga0466725_421755 | 3300042654 | Bacteria | 1575 |
| 63 | Ga0466727_031162 | 3300042655 | Bacteria | 20751 |
| 64 | Ga0466696_054964 | 3300042596 | Bacteria | 2076 |
| 65 | Ga0466696_253683 | 3300042596 | Bacteria | 2727 |
| 66 | Ga0123356_11229413 | 3300010049 | Bacteria | 914 |
| 67 | Ga0123353_10158268 | 3300010167 | Unclassified | 3608 |
| 68 | Ga0123353_10916567 | 3300010167 | Unclassified | 1191 |
| 69 | Ga0123353_11483997 | 3300010167 | Bacteria | 865 |
| 70 | Ga0123354_10096375 | 3300010882 | Bacteria | 4041 |
| 71 | Ga0123354_10577235 | 3300010882 | Bacteria | 835 |
| 72 | Ga0466707_371805 | 3300042601 | Bacteria | 1171 |
| 73 | Ga0466719_098164 | 3300042606 | Bacteria | 7047 |
| 74 | Ga0466721_139283 | 3300042608 | Bacteria | 240312 |
| 75 | Ga0466722_036221 | 3300042609 | Bacteria | 5872 |
| 76 | IMNBL1DRAFT_c0015005 | 3300000062 | Bacteria | 3383 |
| 77 | Ga0466705_342975 | 3300042612 | Bacteria | 3108 |
| 78 | Ga0466733_083610 | 3300042659 | Bacteria | 33057 |
| 79 | Ga0466733_142726 | 3300042659 | Bacteria | 11205 |
| 80 | Ga0466715_472370 | 3300042616 | Bacteria | 1922 |
| 81 | Ga0466715_517576 | 3300042616 | Bacteria | 14317 |
| 82 | Ga0466723_032722 | 3300042618 | Bacteria | 17727 |
| 83 | Ga0466723_260824 | 3300042618 | Bacteria | 11424 |
| 84 | Ga0466726_200288 | 3300042619 | Bacteria | 6114 |
| 85 | Ga0466735_051965 | 3300042624 | Bacteria | 2743 |
| 86 | Ga0466696_256485 | 3300042596 | Bacteria | 22463 |
| 87 | Ga0123356_10042654 | 3300010049 | Bacteria | 4224 |
| 88 | Ga0123356_10155132 | 3300010049 | Bacteria | 2279 |
| 89 | Ga0123353_10006824 | 3300010167 | Bacteria | 15314 |
| 90 | Ga0466707_063341 | 3300042601 | Unclassified | 3102 |
| 91 | Ga0466713_090015 | 3300042602 | Bacteria | 15622 |
| 92 | Ga0466722_148707 | 3300042609 | Bacteria | 7298 |
| 93 | Ga0466722_218510 | 3300042609 | Bacteria | 1304 |
| 94 | Ga0466705_124922 | 3300042612 | Bacteria | 2284 |
| 95 | Ga0466705_384739 | 3300042612 | Bacteria | 6341 |
| 96 | Ga0466711_019447 | 3300042615 | Unclassified | 2426 |
| 97 | Ga0466723_096092 | 3300042618 | Bacteria | 1598 |
| 98 | Ga0466726_330097 | 3300042619 | Bacteria | 4224 |
| 99 | Ga0466703_102327 | 3300042636 | Bacteria | 38440 |
| 100 | Ga0466708_448736 | 3300042652 | Bacteria | 5090 |
| 101 | Ga0160469_101585 | 3300012824 | Bacteria | 5705 |
| 102 | Ga0123357_10923063 | 3300009784 | Bacteria | 559 |
| 103 | Ga0123355_10486281 | 3300009826 | Bacteria | 1532 |
| 104 | Ga0123356_13114794 | 3300010049 | Unclassified | 578 |
| 105 | Ga0123354_10095142 | 3300010882 | Bacteria | 4079 |
| 106 | Ga0466706_285529 | 3300042599 | Bacteria | 349558 |
| 107 | Ga0466713_154997 | 3300042602 | Bacteria | 6430 |
| 108 | JGI24695J34938_10008530 | 3300002450 | Unclassified | 5833 |
| 109 | Ga0068305_10154857 | 3300005083 | Bacteria | 3064 |
| 110 | Ga0102738_1002993 | 3300007141 | Bacteria | 2495 |
| 111 | Ga0466711_036811 | 3300042615 | Bacteria | 1952 |
| 112 | Ga0466711_216942 | 3300042615 | Bacteria | 1039 |
| 113 | Ga0466715_596928 | 3300042616 | Bacteria | 1574 |
| 114 | Ga0466726_457636 | 3300042619 | Bacteria | 4525 |
| 115 | Ga0466703_153925 | 3300042636 | Bacteria | 7231 |
| 116 | Ga0466703_340872 | 3300042636 | Unclassified | 1208 |
| 117 | Ga0466724_36372 | 3300042649 | Bacteria | 3322 |
| 118 | Ga0466691_027408 | 3300042593 | Bacteria | 8740 |
| 119 | Ga0466691_209111 | 3300042593 | Bacteria | 3432 |
| 120 | Ga0466696_091837 | 3300042596 | Bacteria | 1156 |
| 121 | Ga0123356_11112932 | 3300010049 | Bacteria | 958 |
| 122 | Ga0123353_11161102 | 3300010167 | Unclassified | 1018 |
| 123 | Ga0123354_10054798 | 3300010882 | Bacteria | 5977 |
| 124 | Ga0466706_041364 | 3300042599 | Bacteria | 1013 |
| 125 | Ga0466707_047601 | 3300042601 | Bacteria | 5197 |
| 126 | Ga0466707_104504 | 3300042601 | Bacteria | 6395 |
| 127 | Ga0466719_194996 | 3300042606 | Bacteria | 11724 |
| 128 | Ga0466697_255460 | 3300042611 | Bacteria | 6949 |
| 129 | Ga0466711_168060 | 3300042615 | Bacteria | 9509 |
| 130 | Ga0466715_298660 | 3300042616 | Bacteria | 7345 |
| 131 | Ga0466708_362965 | 3300042652 | Bacteria | 4488 |
| 132 | Ga0160453_100158 | 3300012814 | Bacteria | 68251 |
| 133 | Ga0415639_006679 | 3300038395 | Bacteria | 7396 |
| 134 | Ga0466696_387312 | 3300042596 | Bacteria | 2878 |
| 135 | Ga0466696_477366 | 3300042596 | Unclassified | 2414 |
| 136 | Ga0466696_488893 | 3300042596 | Bacteria | 2261 |
| 137 | Ga0123356_10070154 | 3300010049 | Unclassified | 3286 |
| 138 | Ga0123356_10196283 | 3300010049 | Bacteria | 2054 |
| 139 | Ga0123356_10414576 | 3300010049 | Bacteria | 1487 |
| 140 | Ga0123356_13607975 | 3300010049 | Unclassified | 536 |
| 141 | Ga0123353_10822064 | 3300010167 | Unclassified | 1279 |
| 142 | Ga0123353_11509360 | 3300010167 | Bacteria | 855 |
| 143 | Ga0123354_10099402 | 3300010882 | Bacteria | 3947 |
| 144 | Ga0123354_10162287 | 3300010882 | Bacteria | 2646 |
| 145 | Ga0466706_181512 | 3300042599 | Bacteria | 3387 |
| 146 | Ga0466713_138385 | 3300042602 | Bacteria | 336961 |
| 147 | 2227097473 | 2225789004 | Bacteria | 9697 |
| 148 | IMNBL1DRAFT_c0023335 | 3300000062 | Unclassified | 2425 |
| 149 | IMNBL1DRAFT_c0073649 | 3300000062 | Bacteria | 977 |
| 150 | Ga0072941_1110720 | 3300005201 | Bacteria | 5226 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300009784 | Ga0123357_10923063 | Ga0123357_109230632 | 88 |
| 2 | 3300042636 | Ga0466703_216355 | Ga0466703_216355_2855_3220 | 91 |
| 3 | 3300010167 | Ga0123353_10916567 | Ga0123353_109165672 | 98 |
| 4 | 2225789004 | 2227247441 | 2227688699 | 99 |
| 5 | 3300000062 | IMNBL1DRAFT_c0023335 | IMNBL1DRAFT_00233352 | 99 |
| 6 | 3300010167 | Ga0123353_10328469 | Ga0123353_103284692 | 100 |
| 7 | 3300042599 | Ga0466706_156699 | Ga0466706_156699_990_1358 | 100 |
| 8 | 3300042602 | Ga0466713_154997 | Ga0466713_154997_3589_3963 | 100 |
| 9 | 3300042612 | Ga0466705_342975 | Ga0466705_342975_532_900 | 100 |
| 10 | 3300042652 | Ga0466708_448736 | Ga0466708_448736_1612_1980 | 100 |
| 11 | 3300005083 | Ga0068305_10154857 | Ga0068305_101548573 | 101 |
| 12 | 3300010049 | Ga0123356_10102286 | Ga0123356_101022863 | 101 |
| 13 | 3300010049 | Ga0123356_10634717 | Ga0123356_106347172 | 101 |
| 14 | 3300010049 | Ga0123356_13607975 | Ga0123356_136079752 | 101 |
| 15 | 3300010167 | Ga0123353_10396830 | Ga0123353_103968302 | 101 |
| 16 | 3300010882 | Ga0123354_10162287 | Ga0123354_101622872 | 101 |
| 17 | 3300042582 | Ga0466657_140648 | Ga0466657_140648_1211_1591 | 101 |
| 18 | 3300042601 | Ga0466707_047601 | Ga0466707_047601_412_780 | 101 |
| 19 | 3300042601 | Ga0466707_063341 | Ga0466707_063341_491_859 | 101 |
| 20 | 3300042601 | Ga0466707_371805 | Ga0466707_371805_431_796 | 101 |
| 21 | 3300042602 | Ga0466713_090015 | Ga0466713_090015_11142_11516 | 101 |
| 22 | 3300042606 | Ga0466719_098164 | Ga0466719_098164_1815_2180 | 101 |
| 23 | 3300042609 | Ga0466722_036221 | Ga0466722_036221_1844_2209 | 101 |
| 24 | 3300042615 | Ga0466711_168060 | Ga0466711_168060_5163_5528 | 101 |
| 25 | 3300042616 | Ga0466715_543993 | Ga0466715_543993_52568_52945 | 101 |
| 26 | 3300042636 | Ga0466703_153925 | Ga0466703_153925_1925_2290 | 101 |
| 27 | 3300042643 | Ga0466704_111104 | Ga0466704_111104_2345_2716 | 101 |
| 28 | 3300010049 | Ga0123356_10155132 | Ga0123356_101551324 | 102 |
| 29 | 3300010049 | Ga0123356_11112932 | Ga0123356_111129322 | 102 |
| 30 | 3300010167 | Ga0123353_10006824 | Ga0123353_100068249 | 102 |
| 31 | 3300010167 | Ga0123353_11161102 | Ga0123353_111611022 | 102 |
| 32 | 3300010167 | Ga0123353_11390700 | Ga0123353_113907002 | 102 |
| 33 | 3300010882 | Ga0123354_10382190 | Ga0123354_103821902 | 102 |
| 34 | 3300042596 | Ga0466696_091837 | Ga0466696_091837_345_719 | 102 |
| 35 | 3300042596 | Ga0466696_253683 | Ga0466696_253683_2257_2628 | 102 |
| 36 | 3300042601 | Ga0466707_389954 | Ga0466707_389954_1566_1931 | 102 |
| 37 | 3300042611 | Ga0466697_059308 | Ga0466697_059308_1777_2154 | 102 |
| 38 | 3300042612 | Ga0466705_124922 | Ga0466705_124922_1654_2019 | 102 |
| 39 | 3300042612 | Ga0466705_384739 | Ga0466705_384739_4369_4740 | 102 |
| 40 | 3300042615 | Ga0466711_036811 | Ga0466711_036811_919_1284 | 102 |
| 41 | 3300042659 | Ga0466733_142726 | Ga0466733_142726_3868_4248 | 102 |
| 42 | 3300007141 | Ga0102738_1002993 | Ga0102738_10029932 | 103 |
| 43 | 3300007188 | Ga0103264_1000241 | Ga0103264_10002413 | 103 |
| 44 | 3300007192 | Ga0103268_1001098 | Ga0103268_10010987 | 103 |
| 45 | 3300010049 | Ga0123356_10196283 | Ga0123356_101962831 | 103 |
| 46 | 3300010167 | Ga0123353_10158268 | Ga0123353_101582682 | 103 |
| 47 | 3300010167 | Ga0123353_10535217 | Ga0123353_105352173 | 103 |
| 48 | 3300010167 | Ga0123353_13376065 | Ga0123353_133760651 | 103 |
| 49 | 3300010882 | Ga0123354_10054798 | Ga0123354_100547988 | 103 |
| 50 | 3300012824 | Ga0160469_101585 | Ga0160469_1015852 | 103 |
| 51 | 3300022820 | Ga0255809_1024225 | Ga0255809_10242252 | 103 |
| 52 | 3300042599 | Ga0466706_041364 | Ga0466706_041364_255_632 | 103 |
| 53 | 3300042601 | Ga0466707_104504 | Ga0466707_104504_1821_2189 | 103 |
| 54 | 3300042605 | Ga0466716_301925 | Ga0466716_301925_34_363 | 103 |
| 55 | 3300042616 | Ga0466715_170123 | Ga0466715_170123_337_708 | 103 |
| 56 | 3300042616 | Ga0466715_472370 | Ga0466715_472370_666_1037 | 103 |
| 57 | 3300042619 | Ga0466726_457636 | Ga0466726_457636_3746_4114 | 103 |
| 58 | 3300042635 | Ga0466702_460447 | Ga0466702_460447_1315_1692 | 103 |
| 59 | 3300042636 | Ga0466703_102327 | Ga0466703_102327_28298_28672 | 103 |
| 60 | 3300010049 | Ga0123356_10414576 | Ga0123356_104145762 | 104 |
| 61 | 3300010167 | Ga0123353_10822064 | Ga0123353_108220642 | 104 |
| 62 | 3300042593 | Ga0466691_027408 | Ga0466691_027408_6381_6758 | 104 |
| 63 | 3300042600 | Ga0466700_143042 | Ga0466700_143042_940_1311 | 104 |
| 64 | 3300042603 | Ga0466714_019741 | Ga0466714_019741_619_984 | 104 |
| 65 | 3300042609 | Ga0466722_148707 | Ga0466722_148707_128_502 | 104 |
| 66 | 3300042635 | Ga0466702_364574 | Ga0466702_364574_241_630 | 104 |
| 67 | 3300042652 | Ga0466708_194360 | Ga0466708_194360_1036_1416 | 104 |
| 68 | 3300042659 | Ga0466733_079927 | Ga0466733_079927_3290_3664 | 104 |
| 69 | 2225789004 | 2227500465 | 2227982630 | 105 |
| 70 | 3300002450 | JGI24695J34938_10008530 | JGI24695J34938_100085303 | 105 |
| 71 | 3300010049 | Ga0123356_13197519 | Ga0123356_131975191 | 105 |
| 72 | 3300010167 | Ga0123353_11483997 | Ga0123353_114839971 | 105 |
| 73 | 3300010167 | Ga0123353_11552708 | Ga0123353_115527081 | 105 |
| 74 | 3300010882 | Ga0123354_10099402 | Ga0123354_100994023 | 105 |
| 75 | 3300010882 | Ga0123354_10341080 | Ga0123354_103410802 | 105 |
| 76 | 3300042596 | Ga0466696_477366 | Ga0466696_477366_1071_1454 | 105 |
| 77 | 3300042602 | Ga0466713_138385 | Ga0466713_138385_255444_255821 | 105 |
| 78 | 3300042606 | Ga0466719_194996 | Ga0466719_194996_4596_4967 | 105 |
| 79 | 3300042608 | Ga0466721_139283 | Ga0466721_139283_177514_177885 | 105 |
| 80 | 3300042618 | Ga0466723_045605 | Ga0466723_045605_446_814 | 105 |
| 81 | 3300042618 | Ga0466723_260824 | Ga0466723_260824_9948_10325 | 105 |
| 82 | 3300000062 | IMNBL1DRAFT_c0000036 | IMNBL1DRAFT_000003669 | 106 |
| 83 | 3300000062 | IMNBL1DRAFT_c0015005 | IMNBL1DRAFT_00150052 | 106 |
| 84 | 3300000062 | IMNBL1DRAFT_c0073649 | IMNBL1DRAFT_00736492 | 106 |
| 85 | 3300009826 | Ga0123355_10254905 | Ga0123355_102549052 | 106 |
| 86 | 3300010049 | Ga0123356_10070154 | Ga0123356_100701544 | 106 |
| 87 | 3300010167 | Ga0123353_10105806 | Ga0123353_101058066 | 106 |
| 88 | 3300010167 | Ga0123353_12590485 | Ga0123353_125904852 | 106 |
| 89 | 3300010882 | Ga0123354_10096375 | Ga0123354_100963753 | 106 |
| 90 | 3300042615 | Ga0466711_358448 | Ga0466711_358448_620_997 | 106 |
| 91 | 3300042623 | Ga0466734_077527 | Ga0466734_077527_305_667 | 106 |
| 92 | 2225789004 | 2227097473 | 2227479346 | 107 |
| 93 | 3300002504 | JGI24705J35276_12238059 | JGI24705J35276_122380594 | 107 |
| 94 | 3300042611 | Ga0466697_247968 | Ga0466697_247968_277_642 | 107 |
| 95 | 3300009784 | Ga0123357_10022541 | Ga0123357_100225415 | 108 |
| 96 | 3300009826 | Ga0123355_10486281 | Ga0123355_104862813 | 108 |
| 97 | 3300010167 | Ga0123353_11011878 | Ga0123353_110118782 | 108 |
| 98 | 3300009826 | Ga0123355_10528785 | Ga0123355_105287851 | 109 |
| 99 | 3300010167 | Ga0123353_11008427 | Ga0123353_110084272 | 109 |
| 100 | 3300042596 | Ga0466696_387312 | Ga0466696_387312_663_1025 | 109 |
| 101 | 3300042611 | Ga0466697_255460 | Ga0466697_255460_6070_6462 | 109 |
| 102 | 3300042616 | Ga0466715_596928 | Ga0466715_596928_908_1276 | 109 |
| 103 | 3300042618 | Ga0466723_032722 | Ga0466723_032722_15855_16232 | 109 |
| 104 | 3300042618 | Ga0466723_096092 | Ga0466723_096092_1158_1535 | 109 |
| 105 | 3300042636 | Ga0466703_133335 | Ga0466703_133335_2209_2580 | 109 |
| 106 | 3300042649 | Ga0466724_36372 | Ga0466724_36372_1922_2314 | 109 |
| 107 | 2225789004 | 2227646819 | 2228239387 | 110 |
| 108 | 3300042596 | Ga0466696_488893 | Ga0466696_488893_208_609 | 110 |
| 109 | 3300042616 | Ga0466715_170758 | Ga0466715_170758_109_474 | 110 |
| 110 | 3300042616 | Ga0466715_298660 | Ga0466715_298660_4167_4535 | 110 |
| 111 | 3300042596 | Ga0466696_054964 | Ga0466696_054964_332_703 | 111 |
| 112 | 3300042615 | Ga0466711_216942 | Ga0466711_216942_336_707 | 111 |
| 113 | 3300042635 | Ga0466702_088633 | Ga0466702_088633_298_690 | 111 |
| 114 | 3300042643 | Ga0466704_353221 | Ga0466704_353221_4317_4688 | 111 |
| 115 | 3300042593 | Ga0466691_209111 | Ga0466691_209111_2936_3313 | 112 |
| 116 | 3300042596 | Ga0466696_256485 | Ga0466696_256485_8005_8367 | 112 |
| 117 | 3300042599 | Ga0466706_181512 | Ga0466706_181512_1266_1646 | 112 |
| 118 | 3300042612 | Ga0466705_139123 | Ga0466705_139123_9145_9507 | 112 |
| 119 | 3300042623 | Ga0466734_151091 | Ga0466734_151091_2864_3232 | 112 |
| 120 | 3300010049 | Ga0123356_10042654 | Ga0123356_100426542 | 113 |
| 121 | 3300010049 | Ga0123356_13114794 | Ga0123356_131147941 | 113 |
| 122 | 3300010882 | Ga0123354_10063581 | Ga0123354_100635812 | 113 |
| 123 | 3300042659 | Ga0466733_083610 | Ga0466733_083610_20761_21150 | 113 |
| 124 | 3300042609 | Ga0466722_218510 | Ga0466722_218510_541_909 | 114 |
| 125 | 3300042652 | Ga0466708_362965 | Ga0466708_362965_3132_3509 | 114 |
| 126 | 3300042599 | Ga0466706_285529 | Ga0466706_285529_115131_115502 | 115 |
| 127 | 3300042636 | Ga0466703_340872 | Ga0466703_340872_422_793 | 115 |
| 128 | 3300010882 | Ga0123354_10095142 | Ga0123354_100951422 | 118 |
| 129 | 3300042655 | Ga0466727_031162 | Ga0466727_031162_15045_15428 | 118 |
| 130 | 3300042594 | Ga0466694_361185 | Ga0466694_361185_225_587 | 120 |
| 131 | iso_pr_bacteria | 2590828840 | 2593258999 | 120 |
| 132 | iso_pr_bacteria | 2820314258 | 2820316302 | 120 |
| 133 | iso_pr_bacteria | 2820324456 | 2820325770 | 120 |
| 134 | iso_pr_bacteria | 2940228231 | 2940230345 | 120 |
| 135 | 3300005201 | Ga0072941_1110720 | Ga0072941_11107202 | 121 |
| 136 | 3300010882 | Ga0123354_10577235 | Ga0123354_105772352 | 121 |
| 137 | 3300042615 | Ga0466711_279408 | Ga0466711_279408_112_477 | 121 |
| 138 | 3300042617 | Ga0466718_089191 | Ga0466718_089191_548_913 | 121 |
| 139 | iso_pr_bacteria | 2590828839 | 2593251990 | 121 |
| 140 | iso_pr_bacteria | 2593339124 | 2595062856 | 121 |
| 141 | 3300010049 | Ga0123356_11229413 | Ga0123356_112294131 | 122 |
| 142 | 3300010167 | Ga0123353_11509360 | Ga0123353_115093602 | 122 |
| 143 | 3300042619 | Ga0466726_330097 | Ga0466726_330097_3815_4183 | 122 |
| 144 | iso_pr_bacteria | 2820357977 | 2820359803 | 122 |
| 145 | 3300010049 | Ga0123356_10335630 | Ga0123356_103356301 | 123 |
| 146 | 3300010049 | Ga0123356_13125127 | Ga0123356_131251271 | 123 |
| 147 | 3300010167 | Ga0123353_10918563 | Ga0123353_109185632 | 123 |
| 148 | 3300042636 | Ga0466703_049466 | Ga0466703_049466_836_1207 | 123 |
| 149 | iso_pr_bacteria | 2820412446 | 2820413724 | 123 |
| 150 | iso_pr_bacteria | 2820593525 | 2820593957 | 123 |
| 151 | 3300042615 | Ga0466711_019447 | Ga0466711_019447_443_817 | 124 |
| 152 | 3300042620 | Ga0466728_171735 | Ga0466728_171735_1154_1558 | 124 |
| 153 | iso_pr_bacteria | 2820234266 | 2820235350 | 124 |
| 154 | iso_pr_bacteria | 2820507989 | 2820509461 | 124 |
| 155 | 3300038395 | Ga0415639_006679 | Ga0415639_006679_2209_2586 | 125 |
| 156 | 3300042654 | Ga0466725_421755 | Ga0466725_421755_189_671 | 125 |
| 157 | iso_pr_bacteria | 2820492969 | 2820494182 | 125 |
| 158 | 3300010049 | Ga0123356_10668158 | Ga0123356_106681581 | 126 |
| 159 | 3300042616 | Ga0466715_517576 | Ga0466715_517576_5501_5881 | 126 |
| 160 | iso_pr_bacteria | 2754412483 | 2755217423 | 126 |
| 161 | 3300042624 | Ga0466735_051965 | Ga0466735_051965_12_401 | 129 |
| 162 | 3300042619 | Ga0466726_200288 | Ga0466726_200288_235_630 | 131 |
| 163 | 3300012814 | Ga0160453_100158 | Ga0160453_10015826 | 140 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.52 | 0.74 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.