Protein Family IF07810

Metagenome Isolate
216 Members
63 Samples
201 Scaffolds
233.93 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_465262|Ga0466715_465262_615_1484
Length
289 aa
Sequence
VKRQVNAGSGLNPNIRNGLNIGYFYSFNAGNEKIIKIHIKIKKNSYFCATKHCFKIQMHRNEDEFLDFSSSLTDVWRLLSVQERDSLRKTASVQHFKKNQKIYSAGDEPENLMCLLNGKVKIYKEGIGGRNQIIRIIKPIQYFAYRAYFAKEKYLTDAAAFEPSVVCMIPMTLLNNILKDNFSLCMFFIRQLSVDLGIAEERTVNLTQKHIRGRLAESLIFLIDSYGLEDDKTINIYLAREDLANLSNMTTANAIRTLSTFASEKVIALDGRKIKVLDEEKLRKISKLG

📊 Sample Types

Isolate 6.9%
Metagenome 93.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.0%
Kalotermitidae 22.6%
Unclassified 12.9%
Blattidae 11.3%
Rhinotermitidae 6.5%
Termopsidae 6.5%
Passalidae 4.8%
Hydrophilidae 3.2%
Hodotermitidae 1.6%
Tenebrionidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 206
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 2923982719 Parabacteroides sp. 52 Isolate Blattidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
21 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
27 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
28 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
31 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
34 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
40 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
41 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
44 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
45 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
46 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
47 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
48 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
49 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
50 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
51 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
52 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
56 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
57 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
58 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
59 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
60 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
61 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
62 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
63 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_209839 3300042612 Bacteria 1642
2 Ga0466733_035383 3300042659 Bacteria 60826
3 Ga0466715_188075 3300042616 Bacteria 87062
4 Ga0466715_397426 3300042616 Bacteria 7446
5 Ga0466715_612586 3300042616 Bacteria 28878
6 Ga0466726_066733 3300042619 Bacteria 1300
7 Ga0466713_088791 3300042602 Bacteria 9773
8 Ga0466713_113431 3300042602 Bacteria 4239
9 Ga0466713_133473 3300042602 Bacteria 3770
10 Ga0466698_305275 3300042610 Bacteria 3858
11 Ga0466690_198924 3300042590 Bacteria 34985
12 Ga0466690_212519 3300042590 Unclassified 7115
13 Ga0466690_254172 3300042590 Bacteria 86143
14 Ga0466696_131716 3300042596 Bacteria 2390
15 Ga0466696_159608 3300042596 Bacteria 4706
16 Ga0466696_188738 3300042596 Bacteria 16635
17 Ga0123357_10006966 3300009784 Bacteria 13896
18 Ga0123357_10036203 3300009784 Bacteria 6716
19 2227582967 2225789004 Bacteria 2493
20 JGI24702J35022_10000263 3300002462 Bacteria 30153
21 JGI24699J35502_11124498 3300002509 Bacteria 3673
22 Ga0068302_10055338 3300005071 Bacteria 4740
23 Ga0068305_10087968 3300005083 Bacteria 23515
24 Ga0068305_10088138 3300005083 Bacteria 6220
25 Ga0123357_10001276 3300009784 Bacteria 26508
26 Ga0466715_377469 3300042616 Bacteria 15072
27 Ga0466723_239231 3300042618 Bacteria 2811
28 Ga0466726_270156 3300042619 Bacteria 11623
29 Ga0466728_030621 3300042620 Bacteria 20610
30 Ga0466701_041820 3300042598 Bacteria 1355
31 Ga0466700_044713 3300042600 Bacteria 11766
32 Ga0466700_222356 3300042600 Bacteria 20172
33 Ga0466713_133464 3300042602 Bacteria 1343
34 Ga0466714_041531 3300042603 Bacteria 1669
35 Ga0466716_494654 3300042605 Bacteria 6477
36 Ga0466719_061701 3300042606 Bacteria 8794
37 Ga0466719_136023 3300042606 Bacteria 12051
38 Ga0466722_245313 3300042609 Bacteria 2130
39 Ga0466690_023424 3300042590 Bacteria 5456
40 Ga0466695_343788 3300042595 Bacteria 1424
41 Ga0123357_10008804 3300009784 Bacteria 12660
42 Ga0123357_10010307 3300009784 Bacteria 11875
43 Ga0123353_10124447 3300010167 Bacteria 4144
44 Ga0123354_10311282 3300010882 Bacteria 1470
45 Ga0466735_064123 3300042624 Bacteria 2582
46 Ga0466704_082857 3300042643 Bacteria 4021
47 2227488530 2225789004 Bacteria 20877
48 JGI24696J40584_12781257 3300002834 Bacteria 837
49 Ga0466705_099969 3300042612 Bacteria 49190
50 Ga0562377_0004 3300056842 Bacteria 3525959
51 Ga0466711_384875 3300042615 Bacteria 47167
52 Ga0466715_151713 3300042616 Bacteria 9966
53 Ga0466723_156953 3300042618 Bacteria 17921
54 Ga0466723_340002 3300042618 Bacteria 6898
55 Ga0466707_130395 3300042601 Bacteria 8519
56 Ga0466707_146418 3300042601 Bacteria 49406
57 Ga0466707_345434 3300042601 Bacteria 28806
58 Ga0466713_054810 3300042602 Bacteria 3609
59 Ga0466713_059533 3300042602 Bacteria 12857
60 Ga0466716_243820 3300042605 Bacteria 3017
61 Ga0466716_312273 3300042605 Bacteria 24118
62 Ga0466698_141822 3300042610 Bacteria 2294
63 Ga0466698_378617 3300042610 Bacteria 2139
64 Ga0466690_291609 3300042590 Bacteria 13482
65 Ga0466692_094398 3300042591 Bacteria 10447
66 Ga0466691_173246 3300042593 Bacteria 3566
67 Ga0466694_383601 3300042594 Bacteria 4141
68 Ga0466696_313638 3300042596 Bacteria 2932
69 Ga0123357_10016803 3300009784 Bacteria 9654
70 Ga0123357_10050186 3300009784 Unclassified 5649
71 Ga0123354_10037202 3300010882 Bacteria 7578
72 Ga0466703_036019 3300042636 Bacteria 12615
73 Ga0466703_342632 3300042636 Bacteria 3089
74 Ga0466703_410999 3300042636 Bacteria 5482
75 Ga0466708_363361 3300042652 Bacteria 12623
76 2227091915 2225789004 Bacteria 9847
77 2227281106 2225789004 Bacteria 1259
78 2227498242 2225789004 Bacteria 3874
79 2227509641 2225789004 Bacteria 3594
80 IMNBL1DRAFT_c0003035 3300000062 Bacteria 11106
81 IMNBL1DRAFT_c0004317 3300000062 Bacteria 8590
82 JGI24702J35022_10003518 3300002462 Bacteria 9431
83 JGI24705J35276_12233643 3300002504 Bacteria 4968
84 Ga0068305_10022527 3300005083 Unclassified 3196
85 Ga0068305_10043967 3300005083 Bacteria 8071
86 Ga0466726_024398 3300042619 Bacteria 3241
87 Ga0466729_091605 3300042621 Bacteria 3245
88 Ga0466729_097238 3300042621 Bacteria 11917
89 Ga0466707_147018 3300042601 Bacteria 6922
90 Ga0466707_154337 3300042601 Bacteria 5566
91 Ga0466713_018261 3300042602 Bacteria 10214
92 Ga0466713_078721 3300042602 Bacteria 3468
93 Ga0466719_148389 3300042606 Bacteria 25322
94 Ga0466656_312695 3300042550 Bacteria 1979
95 Ga0466691_037723 3300042593 Bacteria 24924
96 Ga0466694_309565 3300042594 Bacteria 1403
97 Ga0466696_137422 3300042596 Bacteria 27896
98 Ga0466703_135494 3300042636 Bacteria 14367
99 Ga0466704_041276 3300042643 Bacteria 1320
100 Ga0466704_461175 3300042643 Bacteria 21896
101 Ga0466727_310337 3300042655 Bacteria 2798
102 IMNBL1DRAFT_c0002623 3300000062 Bacteria 12337
103 IMNBL1DRAFT_c0005196 3300000062 Bacteria 7533
104 JGI24702J35022_10014879 3300002462 Bacteria 4285
105 Ga0466733_125775 3300042659 Bacteria 1976
106 Ga0466711_006423 3300042615 Bacteria 3832
107 Ga0466711_043535 3300042615 Bacteria 2813
108 Ga0466711_244447 3300042615 Bacteria 2479
109 Ga0466715_426635 3300042616 Bacteria 10987
110 Ga0466728_252273 3300042620 Bacteria 1883
111 Ga0466707_210070 3300042601 Bacteria 4144
112 Ga0466713_012389 3300042602 Bacteria 9211
113 Ga0466713_044806 3300042602 Bacteria 5986
114 Ga0466713_095637 3300042602 Bacteria 1728
115 Ga0466713_117800 3300042602 Bacteria 6200
116 Ga0466716_018555 3300042605 Bacteria 33125
117 Ga0466716_346281 3300042605 Bacteria 7412
118 Ga0466722_085395 3300042609 Bacteria 6738
119 Ga0466656_064855 3300042550 Bacteria 7925
120 Ga0466690_352002 3300042590 Bacteria 11272
121 Ga0466696_188727 3300042596 Bacteria 4320
122 Ga0466696_427305 3300042596 Bacteria 1192
123 Ga0123354_10009475 3300010882 Bacteria 14914
124 Ga0466703_042063 3300042636 Bacteria 5497
125 Ga0466703_181393 3300042636 Bacteria 10659
126 Ga0466709_292580 3300042648 Bacteria 8167
127 Ga0466709_382075 3300042648 Bacteria 15070
128 Ga0466727_266424 3300042655 Bacteria 8793
129 2227208575 2225789004 Bacteria 7661
130 IMNBL1DRAFT_c0001301 3300000062 Bacteria 18778
131 JGI24698J34947_10090869 3300002449 Bacteria 1402
132 JGI24702J35022_10001619 3300002462 Bacteria 13929
133 JGI24702J35022_10009367 3300002462 Bacteria 5500
134 JGI24702J35022_10033627 3300002462 Bacteria 2743
135 JGI24702J35022_10051982 3300002462 Bacteria 2183
136 JGI24705J35276_12238403 3300002504 Bacteria 21135
137 JGI24699J35502_11134206 3300002509 Bacteria 57169
138 JGI24699J35502_11134227 3300002509 Bacteria 76542
139 JGI24696J40584_12956005 3300002834 Bacteria 2987
140 Ga0068305_10521110 3300005083 Bacteria 1757
141 Ga0466705_519831 3300042612 Bacteria 4677
142 Ga0466710_271525 3300042613 Bacteria 1300
143 Ga0466715_212915 3300042616 Bacteria 24334
144 Ga0466715_465262 3300042616 Bacteria 8035
145 Ga0466723_016799 3300042618 Bacteria 10753
146 Ga0466726_482034 3300042619 Bacteria 2051
147 Ga0466728_018983 3300042620 Bacteria 6115
148 Ga0466706_163906 3300042599 Bacteria 105365
149 Ga0466713_055966 3300042602 Bacteria 71857
150 Ga0466716_105802 3300042605 Bacteria 11974
151 Ga0466722_049476 3300042609 Bacteria 19365
152 Ga0466691_013448 3300042593 Bacteria 43223
153 Ga0123357_10019688 3300009784 Bacteria 9002
154 Ga0123354_10170660 3300010882 Bacteria 2533
155 Ga0466735_062068 3300042624 Bacteria 3817
156 Ga0466703_114630 3300042636 Bacteria 39473
157 Ga0466704_077214 3300042643 Bacteria 23234
158 Ga0466708_016107 3300042652 Bacteria 19240
159 2227472436 2225789004 Bacteria 4804
160 IMNBL1DRAFT_c0048159 3300000062 Unclassified 1369
161 JGI24698J34947_10058060 3300002449 Bacteria 1917
162 Ga0466705_386420 3300042612 Bacteria 2088
163 Ga0466711_083663 3300042615 Bacteria 8945
164 Ga0466711_157753 3300042615 Bacteria 10462
165 Ga0466711_283500 3300042615 Unclassified 3437
166 Ga0466728_026287 3300042620 Bacteria 61001
167 Ga0466713_102907 3300042602 Bacteria 38987
168 Ga0466716_163238 3300042605 Bacteria 17359
169 Ga0466692_075152 3300042591 Bacteria 13452
170 Ga0466696_017263 3300042596 Bacteria 7070
171 Ga0123354_10131475 3300010882 Bacteria 3159
172 Ga0466735_127635 3300042624 Bacteria 5896
173 Ga0466704_048466 3300042643 Bacteria 4649
174 Ga0466704_432232 3300042643 Unclassified 4681
175 Ga0466709_221215 3300042648 Bacteria 16956
176 Ga0466727_024562 3300042655 Bacteria 14593
177 2227072446 2225789003 Bacteria 12951
178 JGI24702J35022_10022247 3300002462 Bacteria 3433
179 Ga0466697_226398 3300042611 Bacteria 1804
180 Ga0466705_031523 3300042612 Unclassified 7491
181 Ga0466733_088649 3300042659 Bacteria 26069
182 Ga0466711_041848 3300042615 Bacteria 64215
183 Ga0466711_048662 3300042615 Bacteria 31707
184 Ga0466715_119024 3300042616 Bacteria 12209
185 Ga0466713_045754 3300042602 Bacteria 8401
186 Ga0466722_237730 3300042609 Unclassified 3999
187 Ga0466690_153982 3300042590 Bacteria 10875
188 Ga0466691_001749 3300042593 Unclassified 13647
189 Ga0466696_244227 3300042596 Bacteria 2212
190 Ga0123357_10016864 3300009784 Unclassified 9637
191 Ga0123357_10360290 3300009784 Bacteria 1378
192 Ga0123354_10045962 3300010882 Bacteria 6676
193 Ga0466704_060179 3300042643 Bacteria 10657
194 Ga0466704_080317 3300042643 Bacteria 16199
195 Ga0466704_304523 3300042643 Bacteria 6110
196 Ga0466727_026605 3300042655 Bacteria 6488
197 IMNBL1DRAFT_c0001047 3300000062 Bacteria 21395
198 JGI24702J35022_10023669 3300002462 Bacteria 3320
199 JGI24699J35502_11133094 3300002509 Bacteria 8675
200 Ga0072941_1203419 3300005201 Bacteria 2523
201 Ga0123357_10000612 3300009784 Bacteria 35430

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_163906 Ga0466706_163906_58615_59316 205
2 3300002462 JGI24702J35022_10001619 JGI24702J35022_100016198 207
3 3300042609 Ga0466722_245313 Ga0466722_245313_1254_1895 213
4 3300042612 Ga0466705_209839 Ga0466705_209839_683_1333 216
5 3300042636 Ga0466703_114630 Ga0466703_114630_23790_24449 219
6 3300042636 Ga0466703_410999 Ga0466703_410999_943_1674 220
7 3300042643 Ga0466704_077214 Ga0466704_077214_5023_5757 220
8 3300042643 Ga0466704_080317 Ga0466704_080317_7999_8730 220
9 iso_pr_bacteria 2695420317 2695486676 225
10 3300042636 Ga0466703_181393 Ga0466703_181393_6668_7348 226
11 3300042606 Ga0466719_148389 Ga0466719_148389_22670_23356 228
12 3300005083 Ga0068305_10022527 Ga0068305_100225275 230
13 3300042616 Ga0466715_212915 Ga0466715_212915_11845_12579 230
14 iso_pr_bacteria 2820778767 2820780885 230
15 3300009784 Ga0123357_10016803 Ga0123357_100168033 231
16 2225789004 2227208575 2227636699 232
17 2225789004 2227472436 2227920285 232
18 2225789004 2227498242 2227977954 232
19 2225789004 2227582967 2228136364 232
20 3300042550 Ga0466656_312695 Ga0466656_312695_833_1531 232
21 3300042590 Ga0466690_212519 Ga0466690_212519_3286_3984 232
22 3300042590 Ga0466690_254172 Ga0466690_254172_14367_15065 232
23 3300042591 Ga0466692_075152 Ga0466692_075152_100_798 232
24 3300042593 Ga0466691_173246 Ga0466691_173246_2496_3194 232
25 3300042594 Ga0466694_383601 Ga0466694_383601_1991_2689 232
26 3300042598 Ga0466701_041820 Ga0466701_041820_21_719 232
27 3300042600 Ga0466700_044713 Ga0466700_044713_5327_6025 232
28 3300042600 Ga0466700_222356 Ga0466700_222356_8598_9296 232
29 3300042601 Ga0466707_130395 Ga0466707_130395_3809_4507 232
30 3300042601 Ga0466707_146418 Ga0466707_146418_23021_23719 232
31 3300042601 Ga0466707_147018 Ga0466707_147018_2648_3346 232
32 3300042601 Ga0466707_210070 Ga0466707_210070_778_1476 232
33 3300042601 Ga0466707_345434 Ga0466707_345434_23091_23789 232
34 3300042602 Ga0466713_012389 Ga0466713_012389_2039_2737 232
35 3300042602 Ga0466713_018261 Ga0466713_018261_2538_3236 232
36 3300042602 Ga0466713_055966 Ga0466713_055966_35930_36628 232
37 3300042602 Ga0466713_078721 Ga0466713_078721_2159_2857 232
38 3300042602 Ga0466713_088791 Ga0466713_088791_2787_3485 232
39 3300042602 Ga0466713_117800 Ga0466713_117800_3063_3761 232
40 3300042602 Ga0466713_133464 Ga0466713_133464_617_1315 232
41 3300042602 Ga0466713_133473 Ga0466713_133473_1424_2122 232
42 3300042605 Ga0466716_346281 Ga0466716_346281_3465_4163 232
43 3300042605 Ga0466716_494654 Ga0466716_494654_1360_2058 232
44 3300042606 Ga0466719_061701 Ga0466719_061701_945_1643 232
45 3300042609 Ga0466722_049476 Ga0466722_049476_8605_9303 232
46 3300042609 Ga0466722_085395 Ga0466722_085395_3478_4176 232
47 3300042609 Ga0466722_237730 Ga0466722_237730_1114_1812 232
48 3300042610 Ga0466698_141822 Ga0466698_141822_489_1187 232
49 3300042610 Ga0466698_378617 Ga0466698_378617_587_1285 232
50 3300042611 Ga0466697_226398 Ga0466697_226398_749_1447 232
51 3300042613 Ga0466710_271525 Ga0466710_271525_530_1228 232
52 3300042615 Ga0466711_043535 Ga0466711_043535_356_1054 232
53 3300042615 Ga0466711_048662 Ga0466711_048662_298_996 232
54 3300042615 Ga0466711_244447 Ga0466711_244447_1444_2142 232
55 3300042616 Ga0466715_119024 Ga0466715_119024_3844_4542 232
56 3300042616 Ga0466715_151713 Ga0466715_151713_6333_7031 232
57 3300042616 Ga0466715_426635 Ga0466715_426635_710_1408 232
58 3300042618 Ga0466723_239231 Ga0466723_239231_262_960 232
59 3300042619 Ga0466726_066733 Ga0466726_066733_94_792 232
60 3300042619 Ga0466726_270156 Ga0466726_270156_8759_9457 232
61 3300042619 Ga0466726_482034 Ga0466726_482034_59_757 232
62 3300042620 Ga0466728_018983 Ga0466728_018983_3720_4418 232
63 3300042621 Ga0466729_091605 Ga0466729_091605_262_960 232
64 3300042621 Ga0466729_097238 Ga0466729_097238_10186_10884 232
65 3300042624 Ga0466735_062068 Ga0466735_062068_1091_1789 232
66 3300042624 Ga0466735_064123 Ga0466735_064123_1443_2141 232
67 3300042624 Ga0466735_127635 Ga0466735_127635_2288_2986 232
68 3300042636 Ga0466703_036019 Ga0466703_036019_5565_6263 232
69 3300042636 Ga0466703_042063 Ga0466703_042063_4021_4719 232
70 3300042636 Ga0466703_135494 Ga0466703_135494_13377_14075 232
71 3300042643 Ga0466704_082857 Ga0466704_082857_3084_3782 232
72 3300042643 Ga0466704_461175 Ga0466704_461175_12640_13338 232
73 3300042652 Ga0466708_016107 Ga0466708_016107_12742_13440 232
74 3300042655 Ga0466727_026605 Ga0466727_026605_3701_4399 232
75 3300042655 Ga0466727_266424 Ga0466727_266424_357_1055 232
76 3300042655 Ga0466727_310337 Ga0466727_310337_367_1065 232
77 iso_pr_bacteria 2820762746 2820764938 232
78 iso_pr_bacteria 2940199050 2940200604 232
79 iso_pr_bacteria 2940209341 2940211627 232
80 iso_pr_bacteria 2940216256 2940217586 232
81 iso_pr_bacteria 2940346213 2940346918 232
82 iso_pr_bacteria 643348524 643423208 232
83 2225789003 2227072446 2227435254 233
84 2225789004 2227091915 2227471229 233
85 3300000062 IMNBL1DRAFT_c0001047 IMNBL1DRAFT_00010478 233
86 3300000062 IMNBL1DRAFT_c0004317 IMNBL1DRAFT_00043173 233
87 3300002462 JGI24702J35022_10003518 JGI24702J35022_100035182 233
88 3300002462 JGI24702J35022_10014879 JGI24702J35022_100148792 233
89 3300002462 JGI24702J35022_10033627 JGI24702J35022_100336272 233
90 3300002504 JGI24705J35276_12233643 JGI24705J35276_122336432 233
91 3300002509 JGI24699J35502_11124498 JGI24699J35502_111244981 233
92 3300002509 JGI24699J35502_11133094 JGI24699J35502_111330943 233
93 3300002509 JGI24699J35502_11134206 JGI24699J35502_1113420649 233
94 3300002834 JGI24696J40584_12781257 JGI24696J40584_127812571 233
95 3300005071 Ga0068302_10055338 Ga0068302_100553382 233
96 3300005083 Ga0068305_10088138 Ga0068305_100881382 233
97 3300005201 Ga0072941_1203419 Ga0072941_12034191 233
98 3300009784 Ga0123357_10000612 Ga0123357_100006127 233
99 3300009784 Ga0123357_10001276 Ga0123357_1000127625 233
100 3300009784 Ga0123357_10006966 Ga0123357_100069669 233
101 3300009784 Ga0123357_10008804 Ga0123357_100088042 233
102 3300009784 Ga0123357_10010307 Ga0123357_100103076 233
103 3300009784 Ga0123357_10016864 Ga0123357_100168645 233
104 3300009784 Ga0123357_10019688 Ga0123357_100196889 233
105 3300009784 Ga0123357_10036203 Ga0123357_100362035 233
106 3300009784 Ga0123357_10050186 Ga0123357_100501861 233
107 3300010167 Ga0123353_10124447 Ga0123353_101244474 233
108 3300010882 Ga0123354_10009475 Ga0123354_100094754 233
109 3300010882 Ga0123354_10037202 Ga0123354_100372022 233
110 3300010882 Ga0123354_10045962 Ga0123354_100459625 233
111 3300010882 Ga0123354_10131475 Ga0123354_101314754 233
112 3300010882 Ga0123354_10170660 Ga0123354_101706603 233
113 3300010882 Ga0123354_10311282 Ga0123354_103112822 233
114 3300042590 Ga0466690_023424 Ga0466690_023424_1505_2206 233
115 3300042590 Ga0466690_153982 Ga0466690_153982_4805_5506 233
116 3300042590 Ga0466690_198924 Ga0466690_198924_5319_6020 233
117 3300042590 Ga0466690_291609 Ga0466690_291609_2255_2956 233
118 3300042593 Ga0466691_001749 Ga0466691_001749_2745_3446 233
119 3300042593 Ga0466691_037723 Ga0466691_037723_1103_1804 233
120 3300042594 Ga0466694_309565 Ga0466694_309565_599_1300 233
121 3300042595 Ga0466695_343788 Ga0466695_343788_329_1030 233
122 3300042596 Ga0466696_017263 Ga0466696_017263_3862_4563 233
123 3300042596 Ga0466696_137422 Ga0466696_137422_17665_18366 233
124 3300042596 Ga0466696_159608 Ga0466696_159608_3429_4130 233
125 3300042596 Ga0466696_188727 Ga0466696_188727_363_1064 233
126 3300042596 Ga0466696_188738 Ga0466696_188738_10107_10808 233
127 3300042596 Ga0466696_244227 Ga0466696_244227_487_1188 233
128 3300042596 Ga0466696_313638 Ga0466696_313638_1119_1820 233
129 3300042596 Ga0466696_427305 Ga0466696_427305_27_728 233
130 3300042602 Ga0466713_059533 Ga0466713_059533_9595_10296 233
131 3300042602 Ga0466713_102907 Ga0466713_102907_8564_9265 233
132 3300042602 Ga0466713_113431 Ga0466713_113431_3262_3963 233
133 3300042605 Ga0466716_018555 Ga0466716_018555_5743_6444 233
134 3300042605 Ga0466716_105802 Ga0466716_105802_3097_3798 233
135 3300042605 Ga0466716_163238 Ga0466716_163238_10263_10964 233
136 3300042605 Ga0466716_243820 Ga0466716_243820_829_1530 233
137 3300042605 Ga0466716_312273 Ga0466716_312273_4396_5097 233
138 3300042606 Ga0466719_136023 Ga0466719_136023_2334_3035 233
139 3300042610 Ga0466698_305275 Ga0466698_305275_1840_2541 233
140 3300042612 Ga0466705_031523 Ga0466705_031523_5196_5897 233
141 3300042612 Ga0466705_099969 Ga0466705_099969_13722_14423 233
142 3300042612 Ga0466705_519831 Ga0466705_519831_3324_4025 233
143 3300042615 Ga0466711_041848 Ga0466711_041848_56336_57037 233
144 3300042615 Ga0466711_083663 Ga0466711_083663_1376_2077 233
145 3300042615 Ga0466711_157753 Ga0466711_157753_9576_10277 233
146 3300042615 Ga0466711_283500 Ga0466711_283500_2505_3206 233
147 3300042616 Ga0466715_188075 Ga0466715_188075_37987_38688 233
148 3300042616 Ga0466715_377469 Ga0466715_377469_2989_3690 233
149 3300042616 Ga0466715_397426 Ga0466715_397426_2373_3074 233
150 3300042616 Ga0466715_612586 Ga0466715_612586_16011_16712 233
151 3300042618 Ga0466723_016799 Ga0466723_016799_4035_4736 233
152 3300042618 Ga0466723_156953 Ga0466723_156953_4991_5692 233
153 3300042620 Ga0466728_030621 Ga0466728_030621_7248_7949 233
154 3300042620 Ga0466728_252273 Ga0466728_252273_981_1682 233
155 3300042636 Ga0466703_342632 Ga0466703_342632_1054_1755 233
156 3300042643 Ga0466704_041276 Ga0466704_041276_395_1096 233
157 3300042643 Ga0466704_048466 Ga0466704_048466_2646_3347 233
158 3300042643 Ga0466704_060179 Ga0466704_060179_4865_5566 233
159 3300042643 Ga0466704_304523 Ga0466704_304523_2970_3671 233
160 3300042643 Ga0466704_432232 Ga0466704_432232_3933_4634 233
161 3300042648 Ga0466709_292580 Ga0466709_292580_5157_5858 233
162 3300042648 Ga0466709_382075 Ga0466709_382075_8334_9035 233
163 3300042652 Ga0466708_363361 Ga0466708_363361_3137_3838 233
164 3300042659 Ga0466733_035383 Ga0466733_035383_2938_3639 233
165 3300042659 Ga0466733_088649 Ga0466733_088649_14075_14776 233
166 3300042659 Ga0466733_125775 Ga0466733_125775_552_1253 233
167 3300056842 Ga0562377_0004 Ga0562377_0004_2241142_2241843 233
168 iso_pr_bacteria 2873600114 2873600895 233
169 iso_pr_bacteria 2873610414 2873611215 233
170 iso_pr_bacteria 2923982719 2923983793 233
171 iso_pr_bacteria 2940195863 2940197956 233
172 iso_pr_bacteria 2940371297 2940371724 233
173 iso_pr_bacteria 8100157865 8100160739 233
174 3300000062 IMNBL1DRAFT_c0005196 IMNBL1DRAFT_00051963 234
175 3300000062 IMNBL1DRAFT_c0048159 IMNBL1DRAFT_00481591 234
176 3300002462 JGI24702J35022_10009367 JGI24702J35022_100093674 234
177 3300002834 JGI24696J40584_12956005 JGI24696J40584_129560054 234
178 3300005083 Ga0068305_10087968 Ga0068305_1008796825 234
179 3300005083 Ga0068305_10521110 Ga0068305_105211102 234
180 3300009784 Ga0123357_10360290 Ga0123357_103602903 234
181 3300042550 Ga0466656_064855 Ga0466656_064855_271_975 234
182 3300042590 Ga0466690_352002 Ga0466690_352002_967_1671 234
183 3300042602 Ga0466713_044806 Ga0466713_044806_2257_2961 234
184 3300042602 Ga0466713_045754 Ga0466713_045754_5788_6492 234
185 iso_pr_bacteria 2820757377 2820759724 235
186 3300002509 JGI24699J35502_11134227 JGI24699J35502_1113422757 236
187 3300042601 Ga0466707_154337 Ga0466707_154337_4656_5366 236
188 3300042602 Ga0466713_095637 Ga0466713_095637_508_1218 236
189 3300042615 Ga0466711_006423 Ga0466711_006423_1794_2507 237
190 3300042593 Ga0466691_013448 Ga0466691_013448_23260_23976 238
191 2225789004 2227488530 2227957692 239
192 3300042603 Ga0466714_041531 Ga0466714_041531_47_766 239
193 3300000062 IMNBL1DRAFT_c0003035 IMNBL1DRAFT_00030356 240
194 3300042602 Ga0466713_054810 Ga0466713_054810_340_1062 240
195 3300042618 Ga0466723_340002 Ga0466723_340002_5318_6043 241
196 3300042619 Ga0466726_024398 Ga0466726_024398_164_892 242
197 3300042620 Ga0466728_026287 Ga0466728_026287_35618_36346 242
198 3300042655 Ga0466727_024562 Ga0466727_024562_11391_12119 242
199 3300000062 IMNBL1DRAFT_c0001301 IMNBL1DRAFT_00013018 244
200 3300005083 Ga0068305_10043967 Ga0068305_100439674 244
201 3300042648 Ga0466709_221215 Ga0466709_221215_11738_12472 244
202 2225789004 2227509641 2228002510 245
203 3300042596 Ga0466696_131716 Ga0466696_131716_200_940 246
204 3300000062 IMNBL1DRAFT_c0002623 IMNBL1DRAFT_000262311 248
205 3300002449 JGI24698J34947_10058060 JGI24698J34947_100580602 248
206 3300002449 JGI24698J34947_10090869 JGI24698J34947_100908692 248
207 3300002462 JGI24702J35022_10000263 JGI24702J35022_1000026310 248
208 3300002462 JGI24702J35022_10022247 JGI24702J35022_100222472 248
209 3300002462 JGI24702J35022_10023669 JGI24702J35022_100236692 248
210 3300002462 JGI24702J35022_10051982 JGI24702J35022_100519823 248
211 3300042591 Ga0466692_094398 Ga0466692_094398_4280_5026 248
212 2225789004 2227281106 2227733010 253
213 3300002504 JGI24705J35276_12238403 JGI24705J35276_122384038 254
214 3300042612 Ga0466705_386420 Ga0466705_386420_681_1571 271
215 3300042615 Ga0466711_384875 Ga0466711_384875_23823_24638 271
216 3300042616 Ga0466715_465262 Ga0466715_465262_615_1484 289

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00027 cNMP_binding Cyclic nucleotide-binding domain 94 181 0.97
PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain 213 285 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.