Protein Family IF07798

Metagenome Isolate
152 Members
63 Samples
136 Scaffolds
193.99 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_439319|Ga0466715_439319_3780_4418
Length
212 aa
Sequence
LGQLFRADMPLVPQTTNPKPLITNKTMTKSKRCEWCGNDPVYVKYHDEEWGKPVHDDRIMFEFLVLEGAQAGLSWITILKRRENYRKAFAEFDPKKVAKFTEKKVEQLMNNNGIIRNRLKITATISNAQAFLAVQKEFGSFSNFLWSFLPDGKPIVGHWQSWSDIPATTELSDRIAKEMKRRGFKFFGSTICYAHLQATGLVNDHIETCPAK

📊 Sample Types

Isolate 10.5%
Metagenome 89.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.3%
Unclassified 22.0%
Kalotermitidae 20.3%
Tenebrionidae 8.5%
Termopsidae 3.4%
Scarabaeidae 1.7%
Rhinotermitidae 1.7%
Hodotermitidae 1.7%
Drosophilidae 1.7%
Passalidae 1.7%

🌳 Taxonomy

Archaea 4
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
2 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 637000113 Francisella tularensis tularensis FSC 198 Isolate
9 8017489919 Lactobacillus brevis EF Isolate Unclassified
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2882250448 Bizionia sp. APA-3 Isolate
14 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
15 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
16 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
40 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
41 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
44 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
45 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
46 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
47 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
48 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
49 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
50 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
56 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
57 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
58 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
59 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
60 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
61 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
62 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
63 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_029512 3300042659 Bacteria 1377
2 Ga0466699_190598 3300042597 Bacteria 6360
3 JGI24695J34938_10001486 3300002450 Bacteria 19789
4 JGI24695J34938_10001655 3300002450 Bacteria 18530
5 JGI24695J34938_10049720 3300002450 Bacteria 1842
6 JGI24695J34938_10133771 3300002450 Bacteria 1011
7 Ga0123354_10064219 3300010882 Bacteria 5386
8 Ga0466718_035668 3300042617 Bacteria 1867
9 Ga0466720_050748 3300042607 Bacteria 48672
10 Ga0466698_305850 3300042610 Bacteria 1767
11 Ga0466709_357538 3300042648 Bacteria 1384
12 Ga0466692_104814 3300042591 Bacteria 8777
13 JGI24698J34947_10023434 3300002449 Unclassified 3304
14 JGI24695J34938_10001875 3300002450 Bacteria 17081
15 JGI24695J34938_10071679 3300002450 Bacteria 1447
16 Ga0466726_010928 3300042619 Bacteria 1545
17 Ga0466726_315760 3300042619 Bacteria 1063
18 Ga0466706_289137 3300042599 Bacteria 7301
19 Ga0466714_085950 3300042603 Bacteria 17609
20 Ga0466717_146192 3300042604 Bacteria 1196
21 Ga0466727_228238 3300042655 Bacteria 2275
22 Ga0466705_323591 3300042612 Bacteria 1740
23 Ga0562378_0082 3300056814 Bacteria 261822
24 Ga0466699_001621 3300042597 Bacteria 1640
25 Ga0466699_281422 3300042597 Bacteria 13155
26 Ga0466699_402011 3300042597 Bacteria 1327
27 JGI24698J34947_10050733 3300002449 Bacteria 2091
28 JGI24695J34938_10010037 3300002450 Bacteria 5221
29 JGI24695J34938_10226170 3300002450 Bacteria 787
30 Ga0123353_10644207 3300010167 Bacteria 1502
31 Ga0466712_003796 3300042614 Bacteria 14120
32 Ga0466714_136719 3300042603 Bacteria 1267
33 Ga0466714_143435 3300042603 Unclassified 4960
34 Ga0466720_059176 3300042607 Bacteria 22433
35 Ga0466720_181849 3300042607 Bacteria 1362
36 Ga0466698_437566 3300042610 Bacteria 1439
37 Ga0562379_0801 3300056790 Bacteria 49967
38 Ga0415639_017234 3300038395 Bacteria 2913
39 Ga0466691_142162 3300042593 Unclassified 1150
40 Ga0466699_166288 3300042597 Bacteria 1324
41 Ga0466699_191521 3300042597 Bacteria 2065
42 JGI24695J34938_10000383 3300002450 Bacteria 43842
43 JGI24695J34938_10001843 3300002450 Bacteria 17250
44 JGI24695J34938_10013271 3300002450 Bacteria 4333
45 JGI24695J34938_10029498 3300002450 Bacteria 2565
46 Ga0072941_1031397 3300005201 Bacteria 6592
47 Ga0123356_11328114 3300010049 Bacteria 882
48 Ga0123353_10932647 3300010167 Unclassified 1177
49 Ga0466712_058952 3300042614 Bacteria 1023
50 Ga0466712_079761 3300042614 Bacteria 1424
51 Ga0466718_164497 3300042617 Bacteria 2443
52 Ga0466723_173415 3300042618 Bacteria 22886
53 Ga0466731_202945 3300042622 Archaea 11397
54 Ga0466704_213000 3300042643 Bacteria 7471
55 Ga0466727_345822 3300042655 Bacteria 2515
56 Ga0466705_383437 3300042612 Unclassified 12342
57 Ga0562379_0461 3300056790 Bacteria 84089
58 Ga0562377_0136 3300056842 Bacteria 216882
59 Ga0562377_0536 3300056842 Bacteria 59580
60 Ga0466690_432467 3300042590 Bacteria 3290
61 Ga0466693_312582 3300042592 Bacteria 1056
62 Ga0466694_176138 3300042594 Bacteria 2475
63 JGI24695J34938_10001516 3300002450 Bacteria 19556
64 JGI24695J34938_10007566 3300002450 Bacteria 6331
65 JGI24695J34938_10082157 3300002450 Bacteria 1330
66 JGI24695J34938_10107238 3300002450 Unclassified 1139
67 JGI24702J35022_10098377 3300002462 Bacteria 1599
68 Ga0123353_10314209 3300010167 Bacteria 2382
69 Ga0123353_11093383 3300010167 Bacteria 1059
70 Ga0466711_006696 3300042615 Bacteria 3120
71 Ga0466719_182777 3300042606 Unclassified 3541
72 Ga0160431_100488 3300012828 Bacteria 16226
73 Ga0415639_034383 3300038395 Bacteria 3702
74 Ga0415639_095175 3300038395 Bacteria 1960
75 Ga0466699_044405 3300042597 Bacteria 4726
76 Ga0466699_056481 3300042597 Archaea 1754
77 2227510482 2225789004 Bacteria 3568
78 AustNasuHG_c1000533 3300000089 Bacteria 13356
79 AustNasuHG_c1004822 3300000089 Bacteria 4832
80 JGI24695J34938_10008240 3300002450 Bacteria 5968
81 JGI24695J34938_10029079 3300002450 Bacteria 2588
82 Ga0123356_10299775 3300010049 Bacteria 1712
83 Ga0466715_439319 3300042616 Bacteria 8937
84 Ga0466700_264962 3300042600 Bacteria 1102
85 Ga0466707_061992 3300042601 Bacteria 54860
86 Ga0466716_340895 3300042605 Unclassified 6312
87 Ga0466720_038241 3300042607 Bacteria 9410
88 Ga0466720_072427 3300042607 Bacteria 7792
89 Ga0466703_287108 3300042636 Bacteria 2686
90 Ga0466704_324299 3300042643 Bacteria 17934
91 Ga0466732_359588 3300042656 Bacteria 9336
92 Ga0562375_2350 3300056856 Unclassified 21430
93 Ga0562374_0053 3300057007 Bacteria 446032
94 Ga0562374_2495 3300057007 Unclassified 15743
95 Ga0466690_266806 3300042590 Bacteria 9932
96 Ga0466694_014513 3300042594 Bacteria 1011
97 Ga0466696_358472 3300042596 Unclassified 5285
98 Ga0466699_022863 3300042597 Bacteria 1549
99 Ga0466699_029899 3300042597 Bacteria 1271
100 Ga0466699_096333 3300042597 Bacteria 2169
101 Ga0466699_435813 3300042597 Bacteria 2891
102 JGI24698J34947_10124396 3300002449 Bacteria 1113
103 JGI24695J34938_10000071 3300002450 Bacteria 85834
104 JGI24695J34938_10002220 3300002450 Bacteria 15105
105 JGI24695J34938_10019114 3300002450 Archaea 3404
106 JGI24695J34938_10026895 3300002450 Bacteria 2727
107 JGI24695J34938_10041193 3300002450 Bacteria 2075
108 JGI24702J35022_10389462 3300002462 Archaea 840
109 Ga0123356_10180890 3300010049 Bacteria 2130
110 Ga0123356_11032968 3300010049 Bacteria 991
111 Ga0123353_10034997 3300010167 Bacteria 7849
112 Ga0466726_429374 3300042619 Bacteria 1002
113 Ga0466700_113570 3300042600 Bacteria 1862
114 Ga0466700_237029 3300042600 Bacteria 1017
115 Ga0466714_065658 3300042603 Bacteria 2923
116 Ga0466717_209629 3300042604 Bacteria 2360
117 Ga0466720_050125 3300042607 Bacteria 15396
118 Ga0466698_208420 3300042610 Bacteria 14419
119 Ga0466727_292468 3300042655 Bacteria 1176
120 Ga0562377_0937 3300056842 Unclassified 37197
121 Ga0466692_177158 3300042591 Bacteria 17341
122 Ga0466694_271490 3300042594 Bacteria 2721
123 AustNasuHG_c1000319 3300000089 Bacteria 16758
124 JGI24698J34947_10005381 3300002449 Bacteria 7025
125 JGI24698J34947_10208889 3300002449 Bacteria 758
126 JGI24695J34938_10000333 3300002450 Bacteria 46505
127 JGI24695J34938_10001187 3300002450 Bacteria 23128
128 JGI24695J34938_10008482 3300002450 Bacteria 5852
129 JGI24702J35022_10111201 3300002462 Bacteria 1506
130 Ga0123357_10505865 3300009784 Bacteria 999
131 Ga0466712_034666 3300042614 Bacteria 27732
132 Ga0466712_054267 3300042614 Bacteria 1192
133 Ga0466700_202387 3300042600 Bacteria 1354
134 Ga0466700_482106 3300042600 Bacteria 1769
135 Ga0466720_229832 3300042607 Bacteria 1154
136 Ga0466727_103042 3300042655 Bacteria 1318

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_289137 Ga0466706_289137_1317_1835 172
2 3300042606 Ga0466719_182777 Ga0466719_182777_2952_3512 176
3 iso_pr_bacteria 2622736579 2623392445 181
4 iso_pr_bacteria 2896843662 2896845991 182
5 iso_pr_bacteria 8017489919 8017490499 182
6 3300056814 Ga0562378_0082 Ga0562378_0082_204271_204825 184
7 3300056856 Ga0562375_2350 Ga0562375_2350_20645_21199 184
8 3300056790 Ga0562379_0801 Ga0562379_0801_5669_6226 185
9 3300042590 Ga0466690_432467 Ga0466690_432467_2440_3000 186
10 3300042593 Ga0466691_142162 Ga0466691_142162_444_1004 186
11 3300042596 Ga0466696_358472 Ga0466696_358472_1056_1616 186
12 3300042605 Ga0466716_340895 Ga0466716_340895_4818_5378 186
13 3300042612 Ga0466705_383437 Ga0466705_383437_11707_12267 186
14 3300042636 Ga0466703_287108 Ga0466703_287108_991_1551 186
15 3300042643 Ga0466704_213000 Ga0466704_213000_329_889 186
16 3300042603 Ga0466714_143435 Ga0466714_143435_3734_4297 187
17 3300042655 Ga0466727_103042 Ga0466727_103042_443_1006 187
18 3300056842 Ga0562377_0136 Ga0562377_0136_168467_169030 187
19 3300056842 Ga0562377_0536 Ga0562377_0536_55845_56408 187
20 3300056842 Ga0562377_0937 Ga0562377_0937_17259_17822 187
21 3300057007 Ga0562374_0053 Ga0562374_0053_364449_365012 187
22 3300057007 Ga0562374_2495 Ga0562374_2495_599_1162 187
23 iso_pr_bacteria 637000113 640742769 187
24 3300038395 Ga0415639_017234 Ga0415639_017234_2169_2735 188
25 3300042603 Ga0466714_085950 Ga0466714_085950_4947_5513 188
26 3300042659 Ga0466733_029512 Ga0466733_029512_260_826 188
27 iso_pr_bacteria 2773857778 2774477514 188
28 iso_pr_bacteria 2781125635 2781278698 188
29 iso_pr_bacteria 2882250448 2882253144 188
30 3300002450 JGI24695J34938_10007566 JGI24695J34938_100075662 189
31 3300002450 JGI24695J34938_10008482 JGI24695J34938_100084823 189
32 3300002450 JGI24695J34938_10013271 JGI24695J34938_100132715 189
33 3300002450 JGI24695J34938_10029498 JGI24695J34938_100294981 189
34 3300002450 JGI24695J34938_10082157 JGI24695J34938_100821571 189
35 3300002450 JGI24695J34938_10107238 JGI24695J34938_101072382 189
36 3300002450 JGI24695J34938_10133771 JGI24695J34938_101337711 189
37 3300002450 JGI24695J34938_10226170 JGI24695J34938_102261701 189
38 iso_pr_bacteria 2740892557 2743951291 189
39 iso_pr_bacteria 2781125642 2781292573 189
40 iso_pr_bacteria 2781125688 2781423445 189
41 3300002450 JGI24695J34938_10000071 JGI24695J34938_1000007129 190
42 3300002450 JGI24695J34938_10001486 JGI24695J34938_1000148613 190
43 3300002450 JGI24695J34938_10001655 JGI24695J34938_100016553 190
44 3300002450 JGI24695J34938_10001843 JGI24695J34938_100018437 190
45 3300002450 JGI24695J34938_10001875 JGI24695J34938_100018759 190
46 3300002450 JGI24695J34938_10019114 JGI24695J34938_100191143 190
47 3300002450 JGI24695J34938_10049720 JGI24695J34938_100497201 190
48 3300002450 JGI24695J34938_10071679 JGI24695J34938_100716792 190
49 3300010882 Ga0123354_10064219 Ga0123354_100642194 190
50 3300042592 Ga0466693_312582 Ga0466693_312582_164_736 190
51 3300042597 Ga0466699_022863 Ga0466699_022863_631_1203 190
52 3300042597 Ga0466699_190598 Ga0466699_190598_5157_5729 190
53 3300042618 Ga0466723_173415 Ga0466723_173415_10716_11288 190
54 3300042655 Ga0466727_228238 Ga0466727_228238_1550_2122 190
55 3300002450 JGI24695J34938_10026895 JGI24695J34938_100268953 191
56 3300012828 Ga0160431_100488 Ga0160431_1004882 191
57 3300042594 Ga0466694_176138 Ga0466694_176138_1570_2145 191
58 3300042610 Ga0466698_208420 Ga0466698_208420_12722_13297 191
59 3300042619 Ga0466726_429374 Ga0466726_429374_253_828 191
60 iso_pr_bacteria 2634166424 2635614480 191
61 iso_pr_bacteria 2781125638 2781284723 191
62 iso_pr_bacteria 2781125641 2781291760 191
63 iso_pr_bacteria 2781125646 2781301880 191
64 3300002450 JGI24695J34938_10000383 JGI24695J34938_1000038333 192
65 3300002450 JGI24695J34938_10001187 JGI24695J34938_1000118717 192
66 3300002450 JGI24695J34938_10010037 JGI24695J34938_100100376 192
67 3300002450 JGI24695J34938_10029079 JGI24695J34938_100290792 192
68 3300002450 JGI24695J34938_10041193 JGI24695J34938_100411934 192
69 3300010167 Ga0123353_10932647 Ga0123353_109326472 192
70 3300042600 Ga0466700_482106 Ga0466700_482106_212_790 192
71 3300042604 Ga0466717_146192 Ga0466717_146192_228_806 192
72 3300042655 Ga0466727_345822 Ga0466727_345822_1158_1736 192
73 3300056790 Ga0562379_0461 Ga0562379_0461_78440_79018 192
74 iso_pr_bacteria 2781125644 2781297002 192
75 3300000089 AustNasuHG_c1000319 AustNasuHG_100031912 193
76 3300002450 JGI24695J34938_10002220 JGI24695J34938_100022209 193
77 3300010049 Ga0123356_10299775 Ga0123356_102997752 193
78 3300038395 Ga0415639_095175 Ga0415639_095175_190_771 193
79 3300042597 Ga0466699_001621 Ga0466699_001621_987_1568 193
80 3300042597 Ga0466699_191521 Ga0466699_191521_26_607 193
81 3300042600 Ga0466700_202387 Ga0466700_202387_224_805 193
82 3300042600 Ga0466700_237029 Ga0466700_237029_246_827 193
83 3300042603 Ga0466714_136719 Ga0466714_136719_153_734 193
84 3300042619 Ga0466726_315760 Ga0466726_315760_374_955 193
85 3300042648 Ga0466709_357538 Ga0466709_357538_472_1053 193
86 2225789004 2227510482 2228004068 194
87 3300002450 JGI24695J34938_10000333 JGI24695J34938_1000033332 194
88 3300010049 Ga0123356_11328114 Ga0123356_113281142 194
89 3300010167 Ga0123353_10034997 Ga0123353_100349974 194
90 3300042597 Ga0466699_056481 Ga0466699_056481_235_819 194
91 3300042597 Ga0466699_096333 Ga0466699_096333_461_1045 194
92 3300042597 Ga0466699_166288 Ga0466699_166288_44_628 194
93 3300042594 Ga0466694_271490 Ga0466694_271490_789_1376 195
94 3300042600 Ga0466700_264962 Ga0466700_264962_480_1067 195
95 3300042610 Ga0466698_437566 Ga0466698_437566_515_1102 195
96 3300002450 JGI24695J34938_10001516 JGI24695J34938_1000151619 196
97 3300002450 JGI24695J34938_10008240 JGI24695J34938_100082406 196
98 3300002462 JGI24702J35022_10098377 JGI24702J35022_100983773 196
99 3300002462 JGI24702J35022_10389462 JGI24702J35022_103894621 196
100 3300010049 Ga0123356_11032968 Ga0123356_110329682 196
101 3300042597 Ga0466699_029899 Ga0466699_029899_300_890 196
102 3300042597 Ga0466699_044405 Ga0466699_044405_1623_2213 196
103 3300042615 Ga0466711_006696 Ga0466711_006696_119_709 196
104 3300042619 Ga0466726_010928 Ga0466726_010928_847_1437 196
105 3300042655 Ga0466727_292468 Ga0466727_292468_44_634 196
106 3300002449 JGI24698J34947_10208889 JGI24698J34947_102088891 197
107 3300010167 Ga0123353_10644207 Ga0123353_106442072 197
108 3300042590 Ga0466690_266806 Ga0466690_266806_2692_3285 197
109 3300042607 Ga0466720_050125 Ga0466720_050125_14632_15225 197
110 3300042614 Ga0466712_054267 Ga0466712_054267_257_850 197
111 3300002449 JGI24698J34947_10050733 JGI24698J34947_100507333 198
112 3300010049 Ga0123356_10180890 Ga0123356_101808902 198
113 3300042591 Ga0466692_177158 Ga0466692_177158_4298_4894 198
114 3300042601 Ga0466707_061992 Ga0466707_061992_1024_1620 198
115 3300042607 Ga0466720_181849 Ga0466720_181849_200_796 198
116 3300002449 JGI24698J34947_10124396 JGI24698J34947_101243963 199
117 3300042591 Ga0466692_104814 Ga0466692_104814_2953_3552 199
118 3300042597 Ga0466699_281422 Ga0466699_281422_9988_10587 199
119 3300042603 Ga0466714_065658 Ga0466714_065658_12_611 199
120 3300042604 Ga0466717_209629 Ga0466717_209629_1618_2217 199
121 3300042607 Ga0466720_050748 Ga0466720_050748_6941_7579 199
122 3300042622 Ga0466731_202945 Ga0466731_202945_1299_1898 199
123 3300009784 Ga0123357_10505865 Ga0123357_105058652 200
124 3300038395 Ga0415639_034383 Ga0415639_034383_1612_2217 201
125 3300042612 Ga0466705_323591 Ga0466705_323591_1014_1619 201
126 3300042643 Ga0466704_324299 Ga0466704_324299_512_1117 201
127 3300042656 Ga0466732_359588 Ga0466732_359588_8576_9181 201
128 iso_pr_bacteria 2781125687 2781419797 201
129 3300000089 AustNasuHG_c1000533 AustNasuHG_10005333 202
130 3300042594 Ga0466694_014513 Ga0466694_014513_223_831 202
131 3300042607 Ga0466720_072427 Ga0466720_072427_6238_6846 202
132 3300042610 Ga0466698_305850 Ga0466698_305850_300_908 202
133 3300042614 Ga0466712_003796 Ga0466712_003796_9581_10189 202
134 3300042614 Ga0466712_034666 Ga0466712_034666_11021_11629 202
135 3300042614 Ga0466712_058952 Ga0466712_058952_19_627 202
136 3300042617 Ga0466718_164497 Ga0466718_164497_933_1541 202
137 3300000089 AustNasuHG_c1004822 AustNasuHG_10048225 203
138 3300002449 JGI24698J34947_10005381 JGI24698J34947_100053816 203
139 3300002449 JGI24698J34947_10023434 JGI24698J34947_100234341 203
140 3300002462 JGI24702J35022_10111201 JGI24702J35022_101112012 203
141 3300005201 Ga0072941_1031397 Ga0072941_10313974 203
142 3300010167 Ga0123353_10314209 Ga0123353_103142092 203
143 3300042597 Ga0466699_402011 Ga0466699_402011_559_1170 203
144 3300010167 Ga0123353_11093383 Ga0123353_110933832 204
145 3300042597 Ga0466699_435813 Ga0466699_435813_732_1346 204
146 3300042607 Ga0466720_059176 Ga0466720_059176_7270_7884 204
147 3300042607 Ga0466720_038241 Ga0466720_038241_378_1001 207
148 3300042614 Ga0466712_079761 Ga0466712_079761_287_922 211
149 3300042616 Ga0466715_439319 Ga0466715_439319_3780_4418 212
150 3300042607 Ga0466720_229832 Ga0466720_229832_264_905 213
151 3300042617 Ga0466718_035668 Ga0466718_035668_641_1306 221
152 3300042600 Ga0466700_113570 Ga0466700_113570_192_890 232

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03352 Adenine_glyco Methyladenine glycosylase 35 210 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.