Protein Family IF07787

Metagenome Isolate
103 Members
37 Samples
98 Scaffolds
339.54 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_410220|Ga0466715_410220_528_1595
Length
355 aa
Sequence
MSQPESFSLEKTTLGSTNLEVTRCAFGALPIQRISFGESVALLRAAYEGGINFYDTAHGYYDSEEKIGAALGGERERVVIASKAPGLDGDLYRRQLDESLRRMRTDYIDVFQFHLAKKVHRPGEPDGLYEAALGAKESGKIRHIGITTHRIGVAMEAAGSGLYETVQFPLSYLSNPGDLELVKACRENGVGLIAMKALSGGLITDARLAWLFMRQYDNVVPIWGLQRMSELEEFLSFERNHPEWTGELREKITRDKAELSDNFCRGCGYCLPCAVNIEVNWVARMPQVLRRMKAEEFLTPEWRGKMKLAEDCVNCGACKSRCPYELDPPAMIAAAYEDYKNFAADWDASRQKARA

📊 Sample Types

Isolate 4.8%
Metagenome 95.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.7%
Kalotermitidae 25.7%
Unclassified 17.1%
Termopsidae 5.7%
Rhinotermitidae 2.9%
Passalidae 2.9%

🌳 Taxonomy

Archaea 1
Bacteria 90
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
2 2820007728 Unclassified Synergistetes Lab288P3bin114 Isolate Unclassified
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
21 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
22 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_337250 3300042612 Bacteria 4436
2 Ga0466720_017369 3300042607 Bacteria 21503
3 Ga0466720_056582 3300042607 Unclassified 7113
4 Ga0466720_080159 3300042607 Bacteria 2889
5 Ga0123355_10033487 3300009826 Bacteria 8347
6 Ga0466711_323549 3300042615 Bacteria 14617
7 Ga0466715_616988 3300042616 Unclassified 1899
8 Ga0264413_114824 3300024493 Bacteria 5432
9 Ga0466694_022308 3300042594 Bacteria 5478
10 Ga0466699_072196 3300042597 Bacteria 50938
11 IMNBL1DRAFT_c0000300 3300000062 Bacteria 42087
12 AustNasuHG_c1000171 3300000089 Bacteria 21002
13 Ga0072940_1003165 3300005200 Bacteria 16443
14 Ga0466732_037934 3300042656 Bacteria 15040
15 Ga0466720_023164 3300042607 Bacteria 11554
16 Ga0466720_030798 3300042607 Bacteria 5285
17 Ga0466720_095243 3300042607 Bacteria 1843
18 Ga0466720_130092 3300042607 Bacteria 12794
19 Ga0466720_182937 3300042607 Bacteria 5637
20 Ga0466729_250396 3300042621 Bacteria 5736
21 Ga0466703_102358 3300042636 Archaea 2229
22 Ga0466708_358966 3300042652 Bacteria 14857
23 Ga0466727_143303 3300042655 Bacteria 3069
24 Ga0123356_10000325 3300010049 Bacteria 54913
25 Ga0466718_002394 3300042617 Unclassified 1435
26 Ga0466718_012908 3300042617 Bacteria 13643
27 Ga0466699_084882 3300042597 Unclassified 5193
28 AustNasuHG_c1012791 3300000089 Unclassified 2891
29 AustNasuHG_c1017026 3300000089 Bacteria 2423
30 JGI24695J34938_10020013 3300002450 Bacteria 3302
31 Ga0072940_1004918 3300005200 Bacteria 32026
32 Ga0466732_188695 3300042656 Bacteria 4780
33 Ga0466732_223663 3300042656 Bacteria 47450
34 Ga0466720_022542 3300042607 Unclassified 1311
35 Ga0466720_029171 3300042607 Unclassified 1249
36 Ga0466715_410220 3300042616 Bacteria 1785
37 Ga0466718_021742 3300042617 Bacteria 6394
38 Ga0466718_033903 3300042617 Bacteria 2276
39 Ga0466699_148187 3300042597 Bacteria 8155
40 Ga0466705_100848 3300042612 Bacteria 5872
41 Ga0466720_063730 3300042607 Bacteria 6174
42 Ga0466720_146312 3300042607 Bacteria 8817
43 Ga0466698_215730 3300042610 Bacteria 24389
44 Ga0123355_10131612 3300009826 Unclassified 3853
45 Ga0123353_10247025 3300010167 Unclassified 2767
46 Ga0466711_124009 3300042615 Bacteria 11168
47 Ga0466718_070153 3300042617 Bacteria 15513
48 Ga0466718_131450 3300042617 Bacteria 2668
49 Ga0415639_049295 3300038395 Bacteria 9079
50 Ga0415639_105311 3300038395 Bacteria 6861
51 Ga0466699_250841 3300042597 Bacteria 13968
52 2230929972 2228664001 Bacteria 6945
53 Ga0466733_005493 3300042659 Bacteria 2965
54 Ga0466720_206616 3300042607 Bacteria 2731
55 Ga0466720_233125 3300042607 Bacteria 4327
56 Ga0123355_10338398 3300009826 Bacteria 2008
57 Ga0123354_10019786 3300010882 Bacteria 10573
58 Ga0466711_506134 3300042615 Bacteria 3761
59 Ga0264413_101301 3300024493 Bacteria 53125
60 Ga0415639_033269 3300038395 Bacteria 9179
61 Ga0415639_104798 3300038395 Unclassified 3210
62 Ga0072940_1007264 3300005200 Bacteria 4908
63 Ga0466713_152072 3300042602 Bacteria 2002
64 Ga0466719_562334 3300042606 Bacteria 1760
65 Ga0466720_107313 3300042607 Bacteria 24749
66 Ga0466720_137070 3300042607 Bacteria 34404
67 Ga0123356_10314491 3300010049 Bacteria 1676
68 Ga0466718_017130 3300042617 Bacteria 4123
69 Ga0466699_228884 3300042597 Bacteria 6116
70 Ga0466699_383788 3300042597 Bacteria 1615
71 Ga0466699_387023 3300042597 Bacteria 13572
72 Ga0072941_1191166 3300005201 Bacteria 2714
73 Ga0466732_060641 3300042656 Bacteria 2164
74 Ga0466720_012424 3300042607 Bacteria 15798
75 Ga0466720_018543 3300042607 Bacteria 131979
76 Ga0466720_030465 3300042607 Bacteria 19413
77 Ga0466720_046734 3300042607 Bacteria 5443
78 Ga0466729_199277 3300042621 Bacteria 6007
79 Ga0123355_10065545 3300009826 Unclassified 5850
80 Ga0466694_078031 3300042594 Bacteria 1170
81 Ga0466696_139212 3300042596 Bacteria 5166
82 Ga0466699_047498 3300042597 Bacteria 13597
83 Ga0466699_147966 3300042597 Bacteria 13012
84 Ga0466699_162843 3300042597 Bacteria 6585
85 Ga0466732_212780 3300042656 Bacteria 1387
86 Ga0466716_366048 3300042605 Bacteria 1799
87 Ga0466720_123026 3300042607 Bacteria 8873
88 Ga0123353_10703299 3300010167 Bacteria 1418
89 Ga0123354_10255344 3300010882 Bacteria 1764
90 Ga0466711_482766 3300042615 Bacteria 2032
91 Ga0466718_030000 3300042617 Bacteria 2801
92 Ga0466726_291746 3300042619 Bacteria 2619
93 Ga0466728_172641 3300042620 Bacteria 34908
94 Ga0466699_053886 3300042597 Bacteria 44491
95 Ga0466699_171036 3300042597 Unclassified 1983
96 IMNBL1DRAFT_c0002771 3300000062 Bacteria 11900
97 IMNBL1DRAFT_c0003016 3300000062 Bacteria 11157
98 JGI24695J34938_10025493 3300002450 Bacteria 2826

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_562334 Ga0466719_562334_760_1689 309
2 3300042615 Ga0466711_506134 Ga0466711_506134_2810_3742 310
3 3300009826 Ga0123355_10065545 Ga0123355_100655453 311
4 3300010167 Ga0123353_10247025 Ga0123353_102470252 324
5 3300009826 Ga0123355_10131612 Ga0123355_101316122 325
6 3300010049 Ga0123356_10314491 Ga0123356_103144912 326
7 3300009826 Ga0123355_10033487 Ga0123355_100334875 327
8 3300042594 Ga0466694_078031 Ga0466694_078031_164_1150 328
9 3300010882 Ga0123354_10019786 Ga0123354_100197865 329
10 3300042605 Ga0466716_366048 Ga0466716_366048_39_1034 331
11 3300002450 JGI24695J34938_10025493 JGI24695J34938_100254933 332
12 3300042597 Ga0466699_072196 Ga0466699_072196_42057_43070 332
13 3300010882 Ga0123354_10255344 Ga0123354_102553441 333
14 3300042659 Ga0466733_005493 Ga0466733_005493_1869_2873 334
15 3300002450 JGI24695J34938_10020013 JGI24695J34938_100200132 335
16 3300038395 Ga0415639_049295 Ga0415639_049295_2190_3197 335
17 3300010167 Ga0123353_10703299 Ga0123353_107032991 336
18 3300038395 Ga0415639_105311 Ga0415639_105311_2044_3054 336
19 3300042617 Ga0466718_012908 Ga0466718_012908_310_1320 336
20 3300042617 Ga0466718_033903 Ga0466718_033903_225_1235 336
21 3300000062 IMNBL1DRAFT_c0002771 IMNBL1DRAFT_00027716 337
22 3300005201 Ga0072941_1191166 Ga0072941_11911662 337
23 3300024493 Ga0264413_101301 Ga0264413_1013014 337
24 3300042597 Ga0466699_250841 Ga0466699_250841_3249_4262 337
25 3300042610 Ga0466698_215730 Ga0466698_215730_21311_22324 337
26 3300042617 Ga0466718_002394 Ga0466718_002394_176_1189 337
27 3300042617 Ga0466718_017130 Ga0466718_017130_2235_3248 337
28 2228664001 2230929972 2230625479 338
29 3300000089 AustNasuHG_c1000171 AustNasuHG_10001715 338
30 3300000089 AustNasuHG_c1012791 AustNasuHG_10127912 338
31 3300005200 Ga0072940_1004918 Ga0072940_100491814 338
32 3300042594 Ga0466694_022308 Ga0466694_022308_310_1326 338
33 3300042597 Ga0466699_147966 Ga0466699_147966_10168_11184 338
34 3300042597 Ga0466699_148187 Ga0466699_148187_4892_5908 338
35 3300042607 Ga0466720_017369 Ga0466720_017369_4432_5448 338
36 3300042607 Ga0466720_018543 Ga0466720_018543_39624_40640 338
37 3300042607 Ga0466720_022542 Ga0466720_022542_89_1105 338
38 3300042607 Ga0466720_030465 Ga0466720_030465_6493_7509 338
39 3300042607 Ga0466720_030798 Ga0466720_030798_263_1279 338
40 3300042607 Ga0466720_056582 Ga0466720_056582_4849_5865 338
41 3300042607 Ga0466720_095243 Ga0466720_095243_207_1223 338
42 3300042607 Ga0466720_123026 Ga0466720_123026_4896_5912 338
43 3300042607 Ga0466720_130092 Ga0466720_130092_9570_10586 338
44 3300042607 Ga0466720_137070 Ga0466720_137070_33102_34118 338
45 3300042607 Ga0466720_146312 Ga0466720_146312_6571_7587 338
46 3300042607 Ga0466720_206616 Ga0466720_206616_779_1795 338
47 3300042607 Ga0466720_233125 Ga0466720_233125_1532_2548 338
48 3300042617 Ga0466718_030000 Ga0466718_030000_1132_2148 338
49 3300042617 Ga0466718_131450 Ga0466718_131450_1428_2444 338
50 3300042656 Ga0466732_037934 Ga0466732_037934_13860_14876 338
51 3300042656 Ga0466732_188695 Ga0466732_188695_3446_4462 338
52 3300042656 Ga0466732_223663 Ga0466732_223663_658_1674 338
53 3300000089 AustNasuHG_c1017026 AustNasuHG_10170262 339
54 3300005200 Ga0072940_1007264 Ga0072940_10072646 339
55 3300042607 Ga0466720_046734 Ga0466720_046734_4089_5108 339
56 3300042607 Ga0466720_107313 Ga0466720_107313_225_1244 339
57 3300042617 Ga0466718_021742 Ga0466718_021742_5025_6044 339
58 3300042617 Ga0466718_070153 Ga0466718_070153_1849_2868 339
59 3300042656 Ga0466732_212780 Ga0466732_212780_203_1222 339
60 3300024493 Ga0264413_114824 Ga0264413_1148246 340
61 3300042597 Ga0466699_162843 Ga0466699_162843_4154_5176 340
62 3300042607 Ga0466720_012424 Ga0466720_012424_4252_5274 340
63 3300042607 Ga0466720_023164 Ga0466720_023164_7426_8448 340
64 3300042607 Ga0466720_080159 Ga0466720_080159_1746_2768 340
65 3300042607 Ga0466720_182937 Ga0466720_182937_1312_2349 340
66 iso_pr_bacteria 2820501819 2820504040 340
67 3300005200 Ga0072940_1003165 Ga0072940_100316513 341
68 3300009826 Ga0123355_10338398 Ga0123355_103383981 341
69 3300042597 Ga0466699_228884 Ga0466699_228884_4932_5957 341
70 3300042597 Ga0466699_383788 Ga0466699_383788_39_1064 341
71 3300042607 Ga0466720_029171 Ga0466720_029171_45_1070 341
72 3300042612 Ga0466705_337250 Ga0466705_337250_2995_4020 341
73 iso_pr_bacteria 2781125662 2781335988 341
74 3300042597 Ga0466699_047498 Ga0466699_047498_10089_11117 342
75 3300042602 Ga0466713_152072 Ga0466713_152072_394_1422 342
76 3300042655 Ga0466727_143303 Ga0466727_143303_1007_2035 342
77 3300042597 Ga0466699_053886 Ga0466699_053886_22206_23237 343
78 3300042597 Ga0466699_084882 Ga0466699_084882_2941_3972 343
79 3300042597 Ga0466699_387023 Ga0466699_387023_439_1470 343
80 3300042615 Ga0466711_323549 Ga0466711_323549_11335_12369 344
81 3300042619 Ga0466726_291746 Ga0466726_291746_981_2015 344
82 3300042621 Ga0466729_199277 Ga0466729_199277_4892_5926 344
83 3300042621 Ga0466729_250396 Ga0466729_250396_3023_4057 344
84 3300000062 IMNBL1DRAFT_c0000300 IMNBL1DRAFT_000030014 345
85 3300000062 IMNBL1DRAFT_c0003016 IMNBL1DRAFT_00030167 345
86 3300042607 Ga0466720_063730 Ga0466720_063730_1312_2349 345
87 3300042656 Ga0466732_060641 Ga0466732_060641_914_1951 345
88 iso_pr_bacteria 2820007728 2820008829 346
89 3300042597 Ga0466699_171036 Ga0466699_171036_276_1319 347
90 3300042615 Ga0466711_124009 Ga0466711_124009_9686_10729 347
91 iso_pr_bacteria 2781125695 2781438869 347
92 3300038395 Ga0415639_104798 Ga0415639_104798_1538_2584 348
93 3300042612 Ga0466705_100848 Ga0466705_100848_1428_2477 349
94 3300042636 Ga0466703_102358 Ga0466703_102358_692_1747 351
95 3300042620 Ga0466728_172641 Ga0466728_172641_32006_33064 352
96 3300042596 Ga0466696_139212 Ga0466696_139212_723_1784 353
97 3300042652 Ga0466708_358966 Ga0466708_358966_13656_14717 353
98 3300038395 Ga0415639_033269 Ga0415639_033269_7131_8198 355
99 3300042615 Ga0466711_482766 Ga0466711_482766_348_1415 355
100 3300042616 Ga0466715_410220 Ga0466715_410220_528_1595 355
101 3300010049 Ga0123356_10000325 Ga0123356_1000032527 360
102 3300042616 Ga0466715_616988 Ga0466715_616988_305_1399 364
103 iso_pr_bacteria 2820347164 2820348138 366

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00248 Aldo_ket_red Aldo/keto reductase family 32 206 0.93
PF13534 Fer4_17 4Fe-4S dicluster domain 263 327 0.81
PF13183 Fer4_8 4Fe-4S dicluster domain 263 325 0.69

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.