Protein Family IF07784

Metagenome Isolate
127 Members
34 Samples
126 Scaffolds
237.83 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_404525|Ga0466715_404525_15388_16125
Length
245 aa
Sequence
MRRKRTLAIILTVLALTLYALPAAADSLPEWFLPLRDAIYEQNLSADEVAGLYFSAKEKAGSELSGADLLVMISRIEYMMGRAYHYEERKREAIARYEAGMAAAEAALKERDSAEGWQMLAENLSQNCTVHAASYAIAHGLNVEKYAKKALAKDQRNTASLFMLAARWVYAPSPFNNIKRGIQMMKDIITNYESEMPPDDLFNVYSSIGYGYLQQKKKADARVWFQKSLEIYPTNKYIRGLYEKI

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 43.8%
Termitidae 37.5%
Rhinotermitidae 9.4%
Termopsidae 6.2%
Unclassified 3.1%

🌳 Taxonomy

Archaea 0
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
21 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_100883 3300024493 Bacteria 42424
2 Ga0264413_115353 3300024493 Bacteria 6815
3 Ga0466692_111303 3300042591 Bacteria 1251
4 Ga0466694_219953 3300042594 Bacteria 2105
5 Ga0466694_336800 3300042594 Bacteria 8829
6 Ga0466712_076054 3300042614 Bacteria 15237
7 Ga0466712_279128 3300042614 Bacteria 7550
8 Ga0466723_097562 3300042618 Bacteria 6134
9 Ga0466723_193953 3300042618 Bacteria 4702
10 Ga0466726_051692 3300042619 Unclassified 1436
11 Ga0466702_403087 3300042635 Bacteria 2931
12 Ga0466703_128497 3300042636 Bacteria 1771
13 Ga0466704_223677 3300042643 Bacteria 60624
14 AustNasuHG_c1001937 3300000089 Bacteria 7456
15 JGI24698J34947_10104402 3300002449 Bacteria 1266
16 Ga0072941_1040161 3300005201 Bacteria 8770
17 Ga0466705_040997 3300042612 Bacteria 13230
18 Ga0466693_186633 3300042592 Bacteria 79738
19 Ga0466711_354854 3300042615 Bacteria 1833
20 Ga0466715_404525 3300042616 Bacteria 27009
21 Ga0466703_046630 3300042636 Bacteria 3764
22 Ga0466709_308706 3300042648 Bacteria 9036
23 Ga0466708_296757 3300042652 Bacteria 8156
24 Ga0466716_332117 3300042605 Bacteria 1503
25 Ga0466722_111218 3300042609 Bacteria 4177
26 Ga0466722_125408 3300042609 Bacteria 1087
27 Ga0466722_159721 3300042609 Bacteria 4539
28 AustNasuHG_c1017577 3300000089 Bacteria 2376
29 AustNasuHG_c1021865 3300000089 Bacteria 2063
30 JGI24698J34947_10009653 3300002449 Bacteria 5289
31 JGI24698J34947_10011838 3300002449 Unclassified 4791
32 JGI24698J34947_10064591 3300002449 Bacteria 1788
33 Ga0072941_1152395 3300005201 Bacteria 2008
34 Ga0466705_231556 3300042612 Bacteria 2205
35 Ga0466691_201062 3300042593 Bacteria 4137
36 Ga0466712_095931 3300042614 Bacteria 14319
37 Ga0466718_028272 3300042617 Bacteria 11992
38 Ga0466718_045028 3300042617 Bacteria 5753
39 Ga0466723_013092 3300042618 Unclassified 2523
40 Ga0466704_239055 3300042643 Bacteria 21412
41 Ga0466727_260199 3300042655 Bacteria 2271
42 Ga0466722_084381 3300042609 Bacteria 43243
43 AustNasuHG_c1000597 3300000089 Bacteria 12761
44 JGI24698J34947_10120836 3300002449 Bacteria 1137
45 Ga0466690_327377 3300042590 Bacteria 2624
46 Ga0466694_233778 3300042594 Bacteria 2503
47 Ga0466718_023747 3300042617 Bacteria 4288
48 Ga0466728_049195 3300042620 Bacteria 9925
49 Ga0466702_345410 3300042635 Bacteria 1920
50 Ga0466704_347189 3300042643 Bacteria 2333
51 Ga0466709_054012 3300042648 Bacteria 6198
52 Ga0466708_031299 3300042652 Bacteria 8597
53 Ga0466708_068696 3300042652 Bacteria 1881
54 Ga0466727_295671 3300042655 Bacteria 4031
55 AustNasuHG_c1022746 3300000089 Bacteria 2010
56 Ga0466705_249636 3300042612 Bacteria 42301
57 Ga0466732_019937 3300042656 Bacteria 24454
58 Ga0466694_008592 3300042594 Bacteria 11846
59 Ga0466694_262738 3300042594 Unclassified 1907
60 Ga0466695_218661 3300042595 Bacteria 43087
61 Ga0466712_058559 3300042614 Bacteria 28216
62 Ga0466712_077919 3300042614 Bacteria 28252
63 Ga0466718_167542 3300042617 Bacteria 1142
64 Ga0466723_306152 3300042618 Unclassified 2328
65 Ga0466728_137540 3300042620 Bacteria 3099
66 Ga0123356_10020062 3300010049 Bacteria 6330
67 Ga0466703_222945 3300042636 Bacteria 19313
68 Ga0466709_141905 3300042648 Bacteria 8632
69 Ga0466709_395365 3300042648 Bacteria 14172
70 Ga0466708_108893 3300042652 Bacteria 3427
71 Ga0466716_212902 3300042605 Bacteria 2392
72 Ga0466719_162124 3300042606 Bacteria 9382
73 Ga0466722_082880 3300042609 Bacteria 2736
74 Ga0466722_158175 3300042609 Bacteria 1485
75 AustNasuHG_c1028067 3300000089 Bacteria 1694
76 JGI24698J34947_10001772 3300002449 Bacteria 11509
77 JGI24698J34947_10090617 3300002449 Bacteria 1404
78 Ga0072941_1086853 3300005201 Bacteria 2245
79 Ga0072941_1302314 3300005201 Bacteria 3022
80 Ga0466690_431940 3300042590 Bacteria 4225
81 Ga0466692_094408 3300042591 Bacteria 6328
82 Ga0466691_142039 3300042593 Bacteria 7903
83 Ga0466691_188243 3300042593 Bacteria 2027
84 Ga0466691_219934 3300042593 Bacteria 9518
85 Ga0466694_076450 3300042594 Bacteria 26319
86 Ga0466712_051021 3300042614 Bacteria 19499
87 Ga0466715_001364 3300042616 Bacteria 11977
88 Ga0466718_116480 3300042617 Bacteria 1314
89 Ga0466728_190985 3300042620 Bacteria 1999
90 Ga0466709_250988 3300042648 Bacteria 4652
91 JGI24698J34947_10001435 3300002449 Bacteria 12537
92 JGI24698J34947_10057402 3300002449 Bacteria 1931
93 Ga0072941_1040268 3300005201 Bacteria 13976
94 Ga0466705_318573 3300042612 Bacteria 8813
95 Ga0466690_311247 3300042590 Bacteria 8108
96 Ga0466690_405156 3300042590 Bacteria 1737
97 Ga0466696_263273 3300042596 Bacteria 3255
98 Ga0466711_206332 3300042615 Bacteria 3854
99 Ga0466723_022703 3300042618 Bacteria 9894
100 Ga0466729_246872 3300042621 Bacteria 1103
101 Ga0466702_464647 3300042635 Bacteria 7935
102 Ga0466704_043646 3300042643 Bacteria 7206
103 Ga0466727_039206 3300042655 Bacteria 2962
104 Ga0466700_413577 3300042600 Bacteria 1188
105 Ga0466719_576166 3300042606 Bacteria 2922
106 JGI24698J34947_10001342 3300002449 Bacteria 12947
107 JGI24698J34947_10026637 3300002449 Bacteria 3071
108 JGI24698J34947_10131621 3300002449 Bacteria 1068
109 JGI24695J34938_10000245 3300002450 Bacteria 52223
110 Ga0072941_1018320 3300005201 Bacteria 6689
111 Ga0072941_1101584 3300005201 Bacteria 2975
112 Ga0466712_017336 3300042614 Bacteria 30893
113 Ga0466712_082916 3300042614 Bacteria 3004
114 Ga0466718_072832 3300042617 Bacteria 7534
115 Ga0466723_207332 3300042618 Bacteria 6867
116 Ga0466703_066674 3300042636 Bacteria 13204
117 Ga0466704_454845 3300042643 Bacteria 60212
118 Ga0466709_206049 3300042648 Bacteria 2824
119 Ga0466727_339125 3300042655 Bacteria 1006
120 Ga0466716_339806 3300042605 Bacteria 2184
121 Ga0466719_063700 3300042606 Bacteria 1100
122 AustNasuHG_c1011658 3300000089 Bacteria 3044
123 JGI24695J34938_10014243 3300002450 Bacteria 4133
124 Ga0072941_1009359 3300005201 Bacteria 34397
125 Ga0072941_1018319 3300005201 Bacteria 8459
126 Ga0072941_1264741 3300005201 Bacteria 1984

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_125408 Ga0466722_125408_103_780 225
2 3300042609 Ga0466722_158175 Ga0466722_158175_483_1163 226
3 3300042635 Ga0466702_345410 Ga0466702_345410_162_878 226
4 3300042594 Ga0466694_219953 Ga0466694_219953_369_1055 228
5 3300042655 Ga0466727_339125 Ga0466727_339125_103_792 229
6 3300042605 Ga0466716_332117 Ga0466716_332117_270_1007 230
7 3300042643 Ga0466704_347189 Ga0466704_347189_346_1038 230
8 3300042656 Ga0466732_019937 Ga0466732_019937_17730_18425 231
9 3300042590 Ga0466690_431940 Ga0466690_431940_2425_3126 233
10 3300042609 Ga0466722_111218 Ga0466722_111218_3008_3709 233
11 3300042618 Ga0466723_097562 Ga0466723_097562_4299_5000 233
12 3300042591 Ga0466692_111303 Ga0466692_111303_458_1162 234
13 3300042594 Ga0466694_008592 Ga0466694_008592_7009_7713 234
14 3300042594 Ga0466694_262738 Ga0466694_262738_843_1547 234
15 3300042594 Ga0466694_336800 Ga0466694_336800_4497_5201 234
16 3300042600 Ga0466700_413577 Ga0466700_413577_256_960 234
17 3300042614 Ga0466712_095931 Ga0466712_095931_8568_9272 234
18 3300042614 Ga0466712_279128 Ga0466712_279128_4069_4773 234
19 3300002449 JGI24698J34947_10001342 JGI24698J34947_1000134210 235
20 3300002449 JGI24698J34947_10001772 JGI24698J34947_100017725 235
21 3300002449 JGI24698J34947_10120836 JGI24698J34947_101208362 235
22 3300005201 Ga0072941_1018320 Ga0072941_10183207 235
23 3300005201 Ga0072941_1040268 Ga0072941_10402689 235
24 3300005201 Ga0072941_1101584 Ga0072941_11015843 235
25 3300024493 Ga0264413_100883 Ga0264413_1008835 235
26 3300042594 Ga0466694_233778 Ga0466694_233778_510_1217 235
27 3300042609 Ga0466722_084381 Ga0466722_084381_30817_31524 235
28 3300042614 Ga0466712_058559 Ga0466712_058559_16928_17635 235
29 3300042614 Ga0466712_076054 Ga0466712_076054_5700_6407 235
30 3300042614 Ga0466712_077919 Ga0466712_077919_11407_12114 235
31 3300042617 Ga0466718_072832 Ga0466718_072832_3273_3980 235
32 3300042635 Ga0466702_403087 Ga0466702_403087_782_1489 235
33 iso_pr_bacteria 2781125644 2781295812 235
34 3300000089 AustNasuHG_c1000597 AustNasuHG_10005976 236
35 3300000089 AustNasuHG_c1001937 AustNasuHG_10019372 236
36 3300000089 AustNasuHG_c1011658 AustNasuHG_10116581 236
37 3300000089 AustNasuHG_c1021865 AustNasuHG_10218652 236
38 3300000089 AustNasuHG_c1022746 AustNasuHG_10227463 236
39 3300000089 AustNasuHG_c1028067 AustNasuHG_10280672 236
40 3300002449 JGI24698J34947_10001435 JGI24698J34947_100014356 236
41 3300002449 JGI24698J34947_10009653 JGI24698J34947_100096532 236
42 3300002449 JGI24698J34947_10011838 JGI24698J34947_100118384 236
43 3300002449 JGI24698J34947_10104402 JGI24698J34947_101044022 236
44 3300002449 JGI24698J34947_10131621 JGI24698J34947_101316211 236
45 3300002450 JGI24695J34938_10000245 JGI24695J34938_1000024526 236
46 3300005201 Ga0072941_1018319 Ga0072941_10183195 236
47 3300005201 Ga0072941_1152395 Ga0072941_11523952 236
48 3300005201 Ga0072941_1302314 Ga0072941_13023142 236
49 3300010049 Ga0123356_10020062 Ga0123356_100200622 236
50 3300024493 Ga0264413_115353 Ga0264413_1153536 236
51 3300042590 Ga0466690_311247 Ga0466690_311247_1745_2455 236
52 3300042590 Ga0466690_327377 Ga0466690_327377_1190_1900 236
53 3300042591 Ga0466692_094408 Ga0466692_094408_2356_3066 236
54 3300042593 Ga0466691_142039 Ga0466691_142039_537_1247 236
55 3300042594 Ga0466694_076450 Ga0466694_076450_6685_7428 236
56 3300042605 Ga0466716_339806 Ga0466716_339806_120_830 236
57 3300042612 Ga0466705_318573 Ga0466705_318573_476_1186 236
58 3300042616 Ga0466715_001364 Ga0466715_001364_4953_5663 236
59 3300042618 Ga0466723_013092 Ga0466723_013092_608_1318 236
60 3300042618 Ga0466723_207332 Ga0466723_207332_3084_3794 236
61 3300042618 Ga0466723_306152 Ga0466723_306152_1129_1839 236
62 3300042620 Ga0466728_190985 Ga0466728_190985_322_1032 236
63 3300042621 Ga0466729_246872 Ga0466729_246872_360_1070 236
64 3300042635 Ga0466702_464647 Ga0466702_464647_1228_1938 236
65 3300042636 Ga0466703_046630 Ga0466703_046630_56_766 236
66 3300042636 Ga0466703_066674 Ga0466703_066674_2014_2724 236
67 3300042643 Ga0466704_223677 Ga0466704_223677_55109_55819 236
68 3300042643 Ga0466704_239055 Ga0466704_239055_5307_6017 236
69 3300042648 Ga0466709_054012 Ga0466709_054012_743_1453 236
70 3300042648 Ga0466709_206049 Ga0466709_206049_704_1414 236
71 3300042648 Ga0466709_395365 Ga0466709_395365_9836_10546 236
72 3300000089 AustNasuHG_c1017577 AustNasuHG_10175772 237
73 3300002450 JGI24695J34938_10014243 JGI24695J34938_100142434 237
74 3300042590 Ga0466690_405156 Ga0466690_405156_517_1230 237
75 3300042592 Ga0466693_186633 Ga0466693_186633_55962_56675 237
76 3300042593 Ga0466691_188243 Ga0466691_188243_1141_1854 237
77 3300042593 Ga0466691_219934 Ga0466691_219934_8019_8732 237
78 3300042596 Ga0466696_263273 Ga0466696_263273_2114_2827 237
79 3300042605 Ga0466716_212902 Ga0466716_212902_1451_2164 237
80 3300042606 Ga0466719_576166 Ga0466719_576166_1232_1945 237
81 3300042612 Ga0466705_040997 Ga0466705_040997_2089_2802 237
82 3300042615 Ga0466711_206332 Ga0466711_206332_1523_2236 237
83 3300042617 Ga0466718_023747 Ga0466718_023747_2788_3501 237
84 3300042617 Ga0466718_028272 Ga0466718_028272_10982_11695 237
85 3300042617 Ga0466718_045028 Ga0466718_045028_781_1494 237
86 3300042617 Ga0466718_116480 Ga0466718_116480_83_796 237
87 3300042618 Ga0466723_022703 Ga0466723_022703_6565_7278 237
88 3300042620 Ga0466728_137540 Ga0466728_137540_1814_2527 237
89 3300042636 Ga0466703_128497 Ga0466703_128497_585_1298 237
90 3300042643 Ga0466704_043646 Ga0466704_043646_1168_1881 237
91 3300042643 Ga0466704_454845 Ga0466704_454845_36153_36866 237
92 3300042648 Ga0466709_141905 Ga0466709_141905_5597_6310 237
93 3300042648 Ga0466709_250988 Ga0466709_250988_3016_3729 237
94 3300042648 Ga0466709_308706 Ga0466709_308706_7383_8096 237
95 3300042652 Ga0466708_031299 Ga0466708_031299_6517_7230 237
96 3300042652 Ga0466708_068696 Ga0466708_068696_338_1051 237
97 3300002449 JGI24698J34947_10090617 JGI24698J34947_100906172 238
98 3300042606 Ga0466719_162124 Ga0466719_162124_2103_2819 238
99 3300042615 Ga0466711_354854 Ga0466711_354854_641_1357 238
100 3300042619 Ga0466726_051692 Ga0466726_051692_184_900 238
101 3300042620 Ga0466728_049195 Ga0466728_049195_4760_5476 238
102 3300042655 Ga0466727_260199 Ga0466727_260199_985_1701 238
103 3300042655 Ga0466727_295671 Ga0466727_295671_1352_2068 238
104 3300005201 Ga0072941_1009359 Ga0072941_100935932 239
105 3300042636 Ga0466703_222945 Ga0466703_222945_11732_12451 239
106 3300005201 Ga0072941_1264741 Ga0072941_12647412 240
107 3300042595 Ga0466695_218661 Ga0466695_218661_4590_5315 241
108 3300042618 Ga0466723_193953 Ga0466723_193953_2312_3040 242
109 3300042593 Ga0466691_201062 Ga0466691_201062_3203_3934 243
110 3300042606 Ga0466719_063700 Ga0466719_063700_64_795 243
111 3300042617 Ga0466718_167542 Ga0466718_167542_350_1132 243
112 3300042652 Ga0466708_108893 Ga0466708_108893_2477_3208 243
113 3300042652 Ga0466708_296757 Ga0466708_296757_878_1609 243
114 3300042655 Ga0466727_039206 Ga0466727_039206_141_875 244
115 3300042609 Ga0466722_159721 Ga0466722_159721_810_1547 245
116 3300042616 Ga0466715_404525 Ga0466715_404525_15388_16125 245
117 3300002449 JGI24698J34947_10064591 JGI24698J34947_100645912 246
118 3300042614 Ga0466712_082916 Ga0466712_082916_182_922 246
119 3300042614 Ga0466712_051021 Ga0466712_051021_14302_15045 247
120 3300002449 JGI24698J34947_10057402 JGI24698J34947_100574022 248
121 3300042609 Ga0466722_082880 Ga0466722_082880_1382_2131 249
122 3300005201 Ga0072941_1040161 Ga0072941_10401612 250
123 3300005201 Ga0072941_1086853 Ga0072941_10868532 250
124 3300042612 Ga0466705_231556 Ga0466705_231556_716_1468 250
125 3300042612 Ga0466705_249636 Ga0466705_249636_39984_40805 273
126 3300042614 Ga0466712_017336 Ga0466712_017336_13304_14128 274
127 3300002449 JGI24698J34947_10026637 JGI24698J34947_100266371 275

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.