Protein Family IF07762

Metagenome Isolate
179 Members
61 Samples
169 Scaffolds
248.23 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_329305|Ga0466715_329305_1502_2290
Length
262 aa
Sequence
MRLRLRENKKDKIMSNLLKGKTAIITGAARGIGKAVAKRFAEEGCNIAFTDLAIDDNARATEAELAAKGVKVKAYASNAANFDDTHKVVENIVADFSRIDILVNNAGITRDGLMLRMTELQWDAVLTVNLKSAFNFIHAVSPVMMRQKSGSIINMSSVVGVHGNAGQANYSASKAGMIGLAKSIAQELGSRGIRANAIAPGFIVTEMTHQLSDDVREEWIKRIPLRRGGTPEDVADVALFLASDLSSYITGQVIQIDGGMNT

📊 Sample Types

Isolate 5.6%
Metagenome 94.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.0%
Kalotermitidae 23.0%
Unclassified 13.1%
Rhinotermitidae 8.2%
Termopsidae 6.6%
Passalidae 3.3%
Blattidae 3.3%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 171
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2590828839 Clostridium sp. 1 Isolate Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
28 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
36 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
37 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
38 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
39 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 2593339124 Clostridium sp. 4 Isolate Termitidae
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
47 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2920168565 Paludibacter sp. 221 Isolate Blattidae
53 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
54 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
55 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
56 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
57 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
58 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
59 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
60 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
61 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_000525 3300042590 Bacteria 32328
2 Ga0466692_073426 3300042591 Bacteria 43614
3 Ga0466691_222548 3300042593 Bacteria 20111
4 Ga0466696_480041 3300042596 Bacteria 1289
5 Ga0466729_300903 3300042621 Bacteria 2584
6 Ga0466735_121841 3300042624 Bacteria 5081
7 Ga0466735_167842 3300042624 Bacteria 3642
8 Ga0466703_018083 3300042636 Bacteria 4847
9 Ga0466703_379112 3300042636 Bacteria 1645
10 Ga0466704_172555 3300042643 Bacteria 11829
11 Ga0123357_10052147 3300009784 Bacteria 5525
12 Ga0123357_10307417 3300009784 Unclassified 1589
13 Ga0123355_10158019 3300009826 Bacteria 3424
14 Ga0466723_005723 3300042618 Bacteria 7983
15 Ga0466726_363155 3300042619 Bacteria 1451
16 Ga0466728_360258 3300042620 Bacteria 5803
17 Ga0466707_087386 3300042601 Bacteria 25499
18 Ga0466707_145942 3300042601 Bacteria 2180
19 Ga0466707_261326 3300042601 Bacteria 4883
20 Ga0466713_109180 3300042602 Bacteria 24782
21 IMNBL1DRAFT_c0014572 3300000062 Bacteria 3461
22 JGI24702J35022_10003201 3300002462 Bacteria 9902
23 JGI24703J35330_11521429 3300002501 Bacteria 1159
24 Ga0466735_130405 3300042624 Bacteria 4502
25 Ga0466708_020647 3300042652 Bacteria 6190
26 Ga0466727_271032 3300042655 Bacteria 1768
27 Ga0123356_10509829 3300010049 Bacteria 1360
28 Ga0123353_10375635 3300010167 Bacteria 2129
29 Ga0466726_142521 3300042619 Bacteria 18957
30 Ga0466706_179674 3300042599 Bacteria 17495
31 Ga0466706_282332 3300042599 Bacteria 32021
32 Ga0466713_132462 3300042602 Bacteria 4687
33 Ga0466713_139014 3300042602 Bacteria 1201
34 Ga0466697_156793 3300042611 Bacteria 4723
35 2227228038 2225789004 Bacteria 7376
36 JGI24702J35022_10038259 3300002462 Bacteria 2561
37 Ga0068302_10060375 3300005071 Bacteria 4678
38 Ga0068305_10009828 3300005083 Bacteria 82865
39 Ga0068305_10023303 3300005083 Bacteria 7787
40 Ga0456237_0000006 3300041968 Bacteria 62306
41 Ga0466692_040197 3300042591 Bacteria 1081
42 Ga0466696_313177 3300042596 Bacteria 11374
43 Ga0466699_082287 3300042597 Bacteria 1486
44 Ga0466735_099042 3300042624 Bacteria 1181
45 Ga0466735_156494 3300042624 Bacteria 2300
46 Ga0466703_150695 3300042636 Bacteria 7729
47 Ga0466703_282611 3300042636 Unclassified 6819
48 Ga0123356_10165033 3300010049 Bacteria 2218
49 Ga0123354_10020792 3300010882 Bacteria 10331
50 Ga0123354_10044892 3300010882 Bacteria 6770
51 Ga0466711_187829 3300042615 Bacteria 15956
52 Ga0466729_016365 3300042621 Bacteria 6989
53 Ga0466706_040982 3300042599 Bacteria 2363
54 Ga0466706_140997 3300042599 Bacteria 4928
55 Ga0466706_173154 3300042599 Bacteria 26903
56 Ga0466700_039627 3300042600 Bacteria 11016
57 Ga0466700_230751 3300042600 Bacteria 4063
58 Ga0466707_240784 3300042601 Bacteria 2167
59 Ga0466707_284882 3300042601 Bacteria 17288
60 Ga0466713_023577 3300042602 Bacteria 2659
61 Ga0466714_011114 3300042603 Bacteria 1213
62 Ga0466714_132550 3300042603 Bacteria 1191
63 Ga0466719_189881 3300042606 Bacteria 5922
64 Ga0466719_484878 3300042606 Bacteria 7887
65 Ga0466722_118575 3300042609 Unclassified 3522
66 Ga0466705_369079 3300042612 Bacteria 2817
67 2227563833 2225789004 Bacteria 2692
68 IMNBL1DRAFT_c0000013 3300000062 Bacteria 180832
69 JGI24699J35502_10973680 3300002509 Bacteria 1245
70 Ga0415639_029890 3300038395 Bacteria 33874
71 Ga0466692_030175 3300042591 Bacteria 39678
72 Ga0466692_037895 3300042591 Bacteria 20664
73 Ga0466735_079356 3300042624 Bacteria 8146
74 Ga0123357_10257990 3300009784 Bacteria 1849
75 Ga0123355_10529735 3300009826 Bacteria 1436
76 Ga0123356_10012807 3300010049 Bacteria 8120
77 Ga0123353_10003150 3300010167 Bacteria 20728
78 Ga0123354_10002953 3300010882 Bacteria 23087
79 Ga0466711_245991 3300042615 Bacteria 8257
80 Ga0466706_005003 3300042599 Bacteria 88622
81 Ga0466706_049528 3300042599 Bacteria 126627
82 Ga0466700_405432 3300042600 Bacteria 27797
83 Ga0466707_042066 3300042601 Bacteria 33916
84 Ga0466707_119850 3300042601 Bacteria 1699
85 Ga0466713_024846 3300042602 Unclassified 1875
86 Ga0466716_251109 3300042605 Bacteria 15660
87 Ga0466719_132659 3300042606 Bacteria 30972
88 IMNBL1DRAFT_c0002769 3300000062 Bacteria 11906
89 JGI24705J35276_12217212 3300002504 Bacteria 2082
90 Ga0123357_10001032 3300009784 Bacteria 28568
91 Ga0466690_048858 3300042590 Bacteria 42701
92 Ga0466694_106298 3300042594 Bacteria 2765
93 Ga0466735_024490 3300042624 Bacteria 16233
94 Ga0466703_122037 3300042636 Bacteria 17789
95 Ga0466704_108937 3300042643 Bacteria 1822
96 Ga0466704_330089 3300042643 Bacteria 6145
97 Ga0466709_008379 3300042648 Bacteria 52460
98 Ga0466727_032376 3300042655 Bacteria 52244
99 Ga0123357_10237058 3300009784 Bacteria 1985
100 Ga0123353_10195207 3300010167 Bacteria 3191
101 Ga0466715_080209 3300042616 Bacteria 5381
102 Ga0466715_583205 3300042616 Bacteria 24186
103 Ga0466729_191822 3300042621 Unclassified 3034
104 Ga0466706_016366 3300042599 Bacteria 4531
105 Ga0466700_368886 3300042600 Bacteria 4757
106 Ga0466713_073953 3300042602 Bacteria 19632
107 Ga0466713_098854 3300042602 Bacteria 24287
108 Ga0466722_029409 3300042609 Bacteria 2760
109 Ga0466722_051599 3300042609 Bacteria 1042
110 Ga0466697_002249 3300042611 Bacteria 1886
111 2227563503 2225789004 Bacteria 52747
112 JGI24699J35502_11133974 3300002509 Bacteria 22272
113 Ga0466657_371113 3300042582 Bacteria 4158
114 Ga0466690_139871 3300042590 Bacteria 13005
115 Ga0466690_156773 3300042590 Bacteria 3990
116 Ga0466692_151269 3300042591 Bacteria 10165
117 Ga0466734_014218 3300042623 Bacteria 2206
118 Ga0466703_122933 3300042636 Bacteria 9570
119 Ga0466709_154165 3300042648 Bacteria 14931
120 Ga0466727_335323 3300042655 Bacteria 2434
121 Ga0123354_10431973 3300010882 Unclassified 1084
122 Ga0466715_405663 3300042616 Bacteria 18925
123 Ga0466706_010424 3300042599 Bacteria 17050
124 Ga0466713_086638 3300042602 Bacteria 6169
125 Ga0466717_096429 3300042604 Bacteria 1184
126 Ga0466716_268235 3300042605 Bacteria 3655
127 Ga0466719_252377 3300042606 Bacteria 6432
128 Ga0466722_007565 3300042609 Bacteria 18233
129 Ga0466722_129498 3300042609 Bacteria 2625
130 Ga0466722_166973 3300042609 Bacteria 14816
131 Ga0466722_175484 3300042609 Bacteria 16031
132 Ga0466705_078007 3300042612 Bacteria 7058
133 Ga0466732_028661 3300042656 Bacteria 90899
134 2227522695 2225789004 Bacteria 3309
135 IMNBL1DRAFT_c0001623 3300000062 Bacteria 16669
136 JGI24695J34938_10072498 3300002450 Bacteria 1436
137 JGI24699J35502_11132371 3300002509 Bacteria 6759
138 JGI24699J35502_11132388 3300002509 Bacteria 6784
139 Ga0466692_121438 3300042591 Bacteria 29354
140 Ga0466696_048279 3300042596 Bacteria 9304
141 Ga0466704_432001 3300042643 Bacteria 2388
142 Ga0466727_095823 3300042655 Bacteria 11264
143 Ga0123356_11223099 3300010049 Unclassified 917
144 Ga0123354_10211254 3300010882 Unclassified 2096
145 Ga0466710_098942 3300042613 Bacteria 1921
146 Ga0466715_329305 3300042616 Bacteria 8640
147 Ga0466715_348253 3300042616 Bacteria 12317
148 Ga0466723_249141 3300042618 Bacteria 8106
149 Ga0466728_424661 3300042620 Bacteria 2849
150 Ga0466706_135756 3300042599 Bacteria 21184
151 Ga0466713_093796 3300042602 Bacteria 2481
152 Ga0466713_121173 3300042602 Bacteria 12626
153 Ga0466713_149150 3300042602 Bacteria 2205
154 Ga0466714_093285 3300042603 Bacteria 105352
155 IMNBL1DRAFT_c0007451 3300000062 Bacteria 5753
156 Ga0072940_1478540 3300005200 Bacteria 1548
157 Ga0466690_222711 3300042590 Bacteria 7609
158 Ga0466693_148422 3300042592 Bacteria 1673
159 Ga0466735_067367 3300042624 Bacteria 8282
160 Ga0466704_362206 3300042643 Bacteria 17907
161 Ga0123357_10257312 3300009784 Bacteria 1853
162 Ga0123354_10000925 3300010882 Bacteria 32969
163 Ga0123354_10018220 3300010882 Bacteria 11007
164 Ga0466711_011990 3300042615 Bacteria 6742
165 Ga0466726_295959 3300042619 Bacteria 9043
166 Ga0466707_072578 3300042601 Bacteria 15033
167 Ga0466707_149735 3300042601 Bacteria 8086
168 Ga0466707_325589 3300042601 Bacteria 6968
169 Ga0466707_362455 3300042601 Bacteria 3607

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_096429 Ga0466717_096429_481_1158 225
2 2225789004 2227563503 2228102619 227
3 iso_pr_bacteria 2820455747 2820455779 238
4 3300042599 Ga0466706_016366 Ga0466706_016366_810_1583 239
5 3300038395 Ga0415639_029890 Ga0415639_029890_3802_4527 241
6 3300000062 IMNBL1DRAFT_c0014572 IMNBL1DRAFT_00145722 244
7 3300005083 Ga0068305_10023303 Ga0068305_1002330310 244
8 3300042602 Ga0466713_139014 Ga0466713_139014_323_1057 244
9 3300005200 Ga0072940_1478540 Ga0072940_14785402 245
10 3300002501 JGI24703J35330_11521429 JGI24703J35330_115214292 246
11 3300042602 Ga0466713_086638 Ga0466713_086638_2680_3420 246
12 iso_pr_bacteria 2590828839 2593253730 246
13 iso_pr_bacteria 2593339124 2595064169 246
14 3300042600 Ga0466700_039627 Ga0466700_039627_8858_9601 247
15 3300042601 Ga0466707_325589 Ga0466707_325589_4889_5632 247
16 2225789004 2227228038 2227663338 248
17 2225789004 2227522695 2228027651 248
18 2225789004 2227563833 2228104054 248
19 3300041968 Ga0456237_0000006 Ga0456237_0000006_1479_2225 248
20 3300042582 Ga0466657_371113 Ga0466657_371113_2270_3016 248
21 3300042590 Ga0466690_139871 Ga0466690_139871_4462_5208 248
22 3300042590 Ga0466690_222711 Ga0466690_222711_1960_2706 248
23 3300042591 Ga0466692_030175 Ga0466692_030175_37859_38605 248
24 3300042591 Ga0466692_040197 Ga0466692_040197_74_820 248
25 3300042591 Ga0466692_073426 Ga0466692_073426_9883_10629 248
26 3300042591 Ga0466692_121438 Ga0466692_121438_7235_7981 248
27 3300042591 Ga0466692_151269 Ga0466692_151269_4770_5516 248
28 3300042592 Ga0466693_148422 Ga0466693_148422_539_1285 248
29 3300042594 Ga0466694_106298 Ga0466694_106298_1997_2743 248
30 3300042596 Ga0466696_048279 Ga0466696_048279_6846_7592 248
31 3300042596 Ga0466696_313177 Ga0466696_313177_4370_5116 248
32 3300042596 Ga0466696_480041 Ga0466696_480041_466_1212 248
33 3300042597 Ga0466699_082287 Ga0466699_082287_113_859 248
34 3300042599 Ga0466706_005003 Ga0466706_005003_31374_32120 248
35 3300042599 Ga0466706_010424 Ga0466706_010424_15585_16331 248
36 3300042599 Ga0466706_040982 Ga0466706_040982_914_1660 248
37 3300042599 Ga0466706_049528 Ga0466706_049528_87686_88432 248
38 3300042599 Ga0466706_135756 Ga0466706_135756_12774_13520 248
39 3300042599 Ga0466706_140997 Ga0466706_140997_3056_3802 248
40 3300042599 Ga0466706_173154 Ga0466706_173154_12507_13253 248
41 3300042599 Ga0466706_179674 Ga0466706_179674_1979_2725 248
42 3300042599 Ga0466706_282332 Ga0466706_282332_7767_8513 248
43 3300042600 Ga0466700_230751 Ga0466700_230751_2613_3359 248
44 3300042600 Ga0466700_368886 Ga0466700_368886_2376_3122 248
45 3300042600 Ga0466700_405432 Ga0466700_405432_12027_12773 248
46 3300042601 Ga0466707_042066 Ga0466707_042066_14732_15478 248
47 3300042601 Ga0466707_087386 Ga0466707_087386_4473_5219 248
48 3300042601 Ga0466707_119850 Ga0466707_119850_249_995 248
49 3300042601 Ga0466707_145942 Ga0466707_145942_509_1255 248
50 3300042601 Ga0466707_149735 Ga0466707_149735_3648_4394 248
51 3300042601 Ga0466707_240784 Ga0466707_240784_828_1574 248
52 3300042601 Ga0466707_284882 Ga0466707_284882_14653_15399 248
53 3300042601 Ga0466707_362455 Ga0466707_362455_387_1133 248
54 3300042602 Ga0466713_073953 Ga0466713_073953_10001_10747 248
55 3300042602 Ga0466713_098854 Ga0466713_098854_5420_6166 248
56 3300042602 Ga0466713_109180 Ga0466713_109180_16287_17033 248
57 3300042602 Ga0466713_149150 Ga0466713_149150_807_1553 248
58 3300042603 Ga0466714_011114 Ga0466714_011114_124_870 248
59 3300042603 Ga0466714_093285 Ga0466714_093285_14563_15309 248
60 3300042603 Ga0466714_132550 Ga0466714_132550_377_1123 248
61 3300042605 Ga0466716_251109 Ga0466716_251109_5790_6536 248
62 3300042605 Ga0466716_268235 Ga0466716_268235_2083_2829 248
63 3300042606 Ga0466719_484878 Ga0466719_484878_2140_2886 248
64 3300042609 Ga0466722_007565 Ga0466722_007565_12052_12798 248
65 3300042609 Ga0466722_051599 Ga0466722_051599_126_872 248
66 3300042609 Ga0466722_129498 Ga0466722_129498_1242_1988 248
67 3300042609 Ga0466722_166973 Ga0466722_166973_10980_11726 248
68 3300042609 Ga0466722_175484 Ga0466722_175484_11847_12593 248
69 3300042611 Ga0466697_156793 Ga0466697_156793_105_851 248
70 3300042612 Ga0466705_078007 Ga0466705_078007_4840_5586 248
71 3300042612 Ga0466705_369079 Ga0466705_369079_990_1736 248
72 3300042613 Ga0466710_098942 Ga0466710_098942_649_1395 248
73 3300042615 Ga0466711_011990 Ga0466711_011990_1765_2511 248
74 3300042615 Ga0466711_187829 Ga0466711_187829_7685_8431 248
75 3300042615 Ga0466711_245991 Ga0466711_245991_3748_4494 248
76 3300042616 Ga0466715_405663 Ga0466715_405663_2585_3331 248
77 3300042618 Ga0466723_249141 Ga0466723_249141_1267_2013 248
78 3300042619 Ga0466726_295959 Ga0466726_295959_3146_3892 248
79 3300042619 Ga0466726_363155 Ga0466726_363155_266_1012 248
80 3300042620 Ga0466728_424661 Ga0466728_424661_1919_2665 248
81 3300042621 Ga0466729_016365 Ga0466729_016365_191_937 248
82 3300042621 Ga0466729_300903 Ga0466729_300903_1601_2347 248
83 3300042624 Ga0466735_024490 Ga0466735_024490_14693_15439 248
84 3300042624 Ga0466735_067367 Ga0466735_067367_679_1425 248
85 3300042624 Ga0466735_099042 Ga0466735_099042_276_1022 248
86 3300042624 Ga0466735_121841 Ga0466735_121841_205_951 248
87 3300042624 Ga0466735_130405 Ga0466735_130405_3235_3981 248
88 3300042624 Ga0466735_156494 Ga0466735_156494_976_1722 248
89 3300042624 Ga0466735_167842 Ga0466735_167842_920_1666 248
90 3300042636 Ga0466703_018083 Ga0466703_018083_604_1350 248
91 3300042636 Ga0466703_122037 Ga0466703_122037_3474_4220 248
92 3300042636 Ga0466703_122933 Ga0466703_122933_7478_8224 248
93 3300042636 Ga0466703_379112 Ga0466703_379112_880_1626 248
94 3300042643 Ga0466704_108937 Ga0466704_108937_247_993 248
95 3300042643 Ga0466704_172555 Ga0466704_172555_256_1002 248
96 3300042643 Ga0466704_330089 Ga0466704_330089_414_1160 248
97 3300042643 Ga0466704_362206 Ga0466704_362206_3610_4356 248
98 3300042643 Ga0466704_432001 Ga0466704_432001_866_1612 248
99 3300042648 Ga0466709_008379 Ga0466709_008379_9208_9954 248
100 3300042648 Ga0466709_154165 Ga0466709_154165_3048_3794 248
101 3300042652 Ga0466708_020647 Ga0466708_020647_2884_3630 248
102 3300042655 Ga0466727_032376 Ga0466727_032376_24489_25235 248
103 3300042655 Ga0466727_095823 Ga0466727_095823_8073_8819 248
104 3300042655 Ga0466727_271032 Ga0466727_271032_10_756 248
105 3300042655 Ga0466727_335323 Ga0466727_335323_915_1661 248
106 3300042656 Ga0466732_028661 Ga0466732_028661_88517_89263 248
107 iso_pr_bacteria 2609459943 2610742703 248
108 iso_pr_bacteria 2820759988 2820761375 248
109 iso_pr_bacteria 2830041218 2830044765 248
110 iso_pr_bacteria 2920168565 2920169230 248
111 iso_pr_bacteria 2940216256 2940217779 248
112 iso_pr_bacteria 2967483437 2967485571 248
113 iso_pr_bacteria 643348524 643423162 248
114 3300000062 IMNBL1DRAFT_c0000013 IMNBL1DRAFT_000001363 249
115 3300000062 IMNBL1DRAFT_c0001623 IMNBL1DRAFT_000162318 249
116 3300000062 IMNBL1DRAFT_c0002769 IMNBL1DRAFT_00027692 249
117 3300000062 IMNBL1DRAFT_c0007451 IMNBL1DRAFT_00074516 249
118 3300002462 JGI24702J35022_10003201 JGI24702J35022_100032014 249
119 3300002504 JGI24705J35276_12217212 JGI24705J35276_122172122 249
120 3300002509 JGI24699J35502_10973680 JGI24699J35502_109736801 249
121 3300002509 JGI24699J35502_11132371 JGI24699J35502_111323717 249
122 3300002509 JGI24699J35502_11132388 JGI24699J35502_111323885 249
123 3300002509 JGI24699J35502_11133974 JGI24699J35502_1113397418 249
124 3300005083 Ga0068305_10009828 Ga0068305_1000982846 249
125 3300009784 Ga0123357_10001032 Ga0123357_1000103216 249
126 3300009784 Ga0123357_10237058 Ga0123357_102370582 249
127 3300009784 Ga0123357_10257990 Ga0123357_102579901 249
128 3300009784 Ga0123357_10307417 Ga0123357_103074171 249
129 3300010049 Ga0123356_10012807 Ga0123356_100128073 249
130 3300010049 Ga0123356_10165033 Ga0123356_101650331 249
131 3300010049 Ga0123356_10509829 Ga0123356_105098292 249
132 3300010049 Ga0123356_11223099 Ga0123356_112230992 249
133 3300010167 Ga0123353_10195207 Ga0123353_101952074 249
134 3300010882 Ga0123354_10000925 Ga0123354_100009259 249
135 3300010882 Ga0123354_10002953 Ga0123354_100029537 249
136 3300010882 Ga0123354_10018220 Ga0123354_100182203 249
137 3300010882 Ga0123354_10020792 Ga0123354_100207924 249
138 3300010882 Ga0123354_10044892 Ga0123354_100448923 249
139 3300010882 Ga0123354_10211254 Ga0123354_102112542 249
140 3300010882 Ga0123354_10431973 Ga0123354_104319732 249
141 3300042590 Ga0466690_000525 Ga0466690_000525_29708_30457 249
142 3300042590 Ga0466690_048858 Ga0466690_048858_27497_28246 249
143 3300042590 Ga0466690_156773 Ga0466690_156773_2021_2770 249
144 3300042591 Ga0466692_037895 Ga0466692_037895_18465_19214 249
145 3300042593 Ga0466691_222548 Ga0466691_222548_10183_10932 249
146 3300042601 Ga0466707_072578 Ga0466707_072578_6996_7745 249
147 3300042601 Ga0466707_261326 Ga0466707_261326_687_1436 249
148 3300042602 Ga0466713_024846 Ga0466713_024846_628_1377 249
149 3300042602 Ga0466713_093796 Ga0466713_093796_994_1743 249
150 3300042602 Ga0466713_121173 Ga0466713_121173_8139_8888 249
151 3300042602 Ga0466713_132462 Ga0466713_132462_2342_3091 249
152 3300042606 Ga0466719_132659 Ga0466719_132659_28708_29457 249
153 3300042606 Ga0466719_189881 Ga0466719_189881_2453_3202 249
154 3300042606 Ga0466719_252377 Ga0466719_252377_1831_2580 249
155 3300042609 Ga0466722_029409 Ga0466722_029409_725_1474 249
156 3300042609 Ga0466722_118575 Ga0466722_118575_718_1467 249
157 3300042611 Ga0466697_002249 Ga0466697_002249_892_1641 249
158 3300042616 Ga0466715_080209 Ga0466715_080209_1555_2304 249
159 3300042616 Ga0466715_348253 Ga0466715_348253_5488_6237 249
160 3300042616 Ga0466715_583205 Ga0466715_583205_13395_14144 249
161 3300042618 Ga0466723_005723 Ga0466723_005723_5011_5760 249
162 3300042619 Ga0466726_142521 Ga0466726_142521_2164_2913 249
163 3300042620 Ga0466728_360258 Ga0466728_360258_994_1743 249
164 3300042621 Ga0466729_191822 Ga0466729_191822_1599_2348 249
165 3300042623 Ga0466734_014218 Ga0466734_014218_522_1271 249
166 3300042624 Ga0466735_079356 Ga0466735_079356_6667_7416 249
167 3300042636 Ga0466703_150695 Ga0466703_150695_1870_2619 249
168 3300042636 Ga0466703_282611 Ga0466703_282611_218_967 249
169 3300002450 JGI24695J34938_10072498 JGI24695J34938_100724982 250
170 3300002462 JGI24702J35022_10038259 JGI24702J35022_100382592 250
171 3300005071 Ga0068302_10060375 Ga0068302_100603755 250
172 3300009784 Ga0123357_10052147 Ga0123357_100521475 250
173 3300009784 Ga0123357_10257312 Ga0123357_102573122 250
174 3300009826 Ga0123355_10158019 Ga0123355_101580192 250
175 3300009826 Ga0123355_10529735 Ga0123355_105297351 251
176 3300010167 Ga0123353_10375635 Ga0123353_103756351 251
177 3300042602 Ga0466713_023577 Ga0466713_023577_1568_2344 258
178 3300042616 Ga0466715_329305 Ga0466715_329305_1502_2290 262
179 3300010167 Ga0123353_10003150 Ga0123353_1000315011 287

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 21 214 0.96
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 27 261 0.93
PF08659 KR KR domain 22 186 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.