Protein Family IF07758

Metagenome Isolate
214 Members
89 Samples
173 Scaffolds
200.31 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_309498|Ga0466715_309498_632_1324
Length
230 aa
Sequence
LIDYDYQQFEITCFHVAKKDFFLKAKHSRINLTMDIDFQKTDGLVPAIIQDVYTSKVLMLGFMNAEALQKTQETGQVTFYSRSKKRLWTKGEESGNFLNVVSVHADCDKDTLLIKVKPVGVVCHTGADTCWNESNDAGFAFLNYLQEFIKIRYDEMPEGSYTTSLFDQGVNRMAQKVGEEAVETVIEAVNGTDEGFLYEASDLLYHLIVLLRSKGYSLDDLGRELKKRHK

πŸ“Š Sample Types

Isolate 19.2%
Metagenome 80.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 27.9%
Termitidae 19.8%
Kalotermitidae 16.3%
Unclassified 10.5%
Rhinotermitidae 7.0%
Aphididae 5.8%
Hydrophilidae 3.5%
Termopsidae 3.5%
Passalidae 2.3%
Drosophilidae 1.2%
Culicidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 208
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
2 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
3 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
4 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
5 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 3300038942 Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar Metagenome Aphididae
8 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
9 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300009477 Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov Metagenome
12 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
17 2558860197 Buchnera aphidicola F009 Isolate Aphididae
18 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
27 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
28 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
29 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
30 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
31 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
32 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
33 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
34 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
35 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
36 3004672520 Bacteroides sp. 51 Isolate Blattidae
37 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
38 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
39 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
45 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
46 2558860196 Buchnera aphidicola W106 Isolate Aphididae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 2998907766 Penaeicola halotolerans LMIT005 Isolate
49 3004667792 Bacteroides sp. 519 Isolate Blattidae
50 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
56 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
57 2558860194 Buchnera aphidicola USDA Isolate Aphididae
58 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
59 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
60 3004677695 Bacteroides sp. 214 Isolate Blattidae
61 2922326829 Bacteroides sp. 224 Isolate Blattidae
62 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
63 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
64 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
65 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
66 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
67 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
68 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
69 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
70 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
71 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
72 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
73 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
74 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
75 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
76 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
77 2558860195 Buchnera aphidicola G002 Isolate Aphididae
78 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
79 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
80 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
81 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
82 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
83 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
84 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
85 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
86 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
87 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
88 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
89 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_047834 3300042659 Bacteria 69270
2 Ga0466711_165558 3300042615 Bacteria 2216
3 Ga0466711_234030 3300042615 Bacteria 4939
4 Ga0466715_194603 3300042616 Bacteria 47231
5 Ga0466728_019567 3300042620 Bacteria 33080
6 Ga0466729_007879 3300042621 Bacteria 30241
7 Ga0466690_394310 3300042590 Bacteria 2729
8 Ga0466691_212540 3300042593 Bacteria 6238
9 Ga0466696_316966 3300042596 Bacteria 3878
10 Ga0466699_254412 3300042597 Bacteria 3166
11 Ga0123354_10005281 3300010882 Bacteria 18726
12 Ga0160465_100068 3300012803 Bacteria 115656
13 Ga0466713_099183 3300042602 Bacteria 118109
14 Ga0466716_129240 3300042605 Bacteria 11148
15 Ga0466719_370215 3300042606 Bacteria 6567
16 Ga0466734_161395 3300042623 Bacteria 1138
17 Ga0466735_044121 3300042624 Bacteria 6045
18 Ga0466735_071826 3300042624 Bacteria 2341
19 Ga0466735_112599 3300042624 Bacteria 6718
20 Ga0466735_160562 3300042624 Bacteria 1820
21 Ga0466703_199268 3300042636 Bacteria 4213
22 Ga0466704_433307 3300042643 Bacteria 1295
23 Ga0466708_008222 3300042652 Bacteria 18738
24 Ga0466708_057780 3300042652 Unclassified 1437
25 2227122482 2225789004 Bacteria 9133
26 Ga0104045_1075598 3300007085 Bacteria 1897
27 Ga0123357_10001078 3300009784 Bacteria 28159
28 Ga0466733_080268 3300042659 Unclassified 3609
29 Ga0466711_238034 3300042615 Bacteria 37187
30 Ga0466711_249317 3300042615 Bacteria 18334
31 Ga0466723_021356 3300042618 Bacteria 5349
32 Ga0466726_295675 3300042619 Bacteria 3137
33 Ga0466728_016956 3300042620 Unclassified 25210
34 Ga0160448_109578 3300012854 Bacteria 2119
35 Ga0120204_000112 3300038942 Bacteria 3897
36 Ga0466690_049656 3300042590 Bacteria 6090
37 Ga0123357_10189477 3300009784 Unclassified 2375
38 Ga0123354_10004885 3300010882 Bacteria 19219
39 Ga0123354_10359539 3300010882 Bacteria 1285
40 Ga0466706_212921 3300042599 Bacteria 20425
41 Ga0466706_280127 3300042599 Bacteria 16167
42 Ga0466713_078988 3300042602 Bacteria 2565
43 Ga0466716_471390 3300042605 Bacteria 4302
44 Ga0466698_266574 3300042610 Bacteria 2046
45 Ga0466729_215081 3300042621 Unclassified 1536
46 Ga0466703_008757 3300042636 Bacteria 6577
47 Ga0466703_020799 3300042636 Bacteria 26501
48 Ga0466703_179942 3300042636 Bacteria 9716
49 Ga0466703_354789 3300042636 Bacteria 4683
50 Ga0466704_442642 3300042643 Bacteria 41618
51 Ga0466727_144340 3300042655 Bacteria 5027
52 Ga0466727_229282 3300042655 Bacteria 1605
53 Ga0466727_287969 3300042655 Bacteria 9196
54 IMNBL1DRAFT_c0005773 3300000062 Bacteria 6961
55 JGI24699J35502_11134210 3300002509 Bacteria 59774
56 Ga0068305_10010571 3300005083 Bacteria 68461
57 Ga0466697_258751 3300042611 Bacteria 1014
58 Ga0466705_191911 3300042612 Bacteria 3296
59 Ga0466712_150496 3300042614 Bacteria 2604
60 Ga0466711_384472 3300042615 Bacteria 1653
61 Ga0466715_020643 3300042616 Bacteria 1514
62 Ga0466728_234203 3300042620 Bacteria 10903
63 Ga0466657_078928 3300042582 Bacteria 14769
64 Ga0123357_10290613 3300009784 Bacteria 1670
65 Ga0466701_050189 3300042598 Bacteria 5312
66 Ga0466706_058332 3300042599 Bacteria 9971
67 Ga0466706_252336 3300042599 Bacteria 30022
68 Ga0466707_044264 3300042601 Bacteria 2534
69 Ga0466707_129085 3300042601 Bacteria 1630
70 Ga0466707_191430 3300042601 Bacteria 1572
71 Ga0466713_035110 3300042602 Bacteria 2140
72 Ga0466713_044454 3300042602 Bacteria 40764
73 Ga0466719_206932 3300042606 Bacteria 1037
74 Ga0466722_036334 3300042609 Bacteria 4666
75 Ga0466703_128842 3300042636 Bacteria 11202
76 Ga0466709_309968 3300042648 Bacteria 3083
77 IMNBL1DRAFT_c0000411 3300000062 Bacteria 36219
78 Ga0466723_209820 3300042618 Bacteria 2222
79 Ga0466691_005883 3300042593 Bacteria 6146
80 Ga0466691_052189 3300042593 Bacteria 7738
81 Ga0466691_058338 3300042593 Bacteria 8322
82 Ga0123357_10010972 3300009784 Bacteria 11572
83 Ga0123357_10194820 3300009784 Bacteria 2324
84 Ga0123357_10198963 3300009784 Bacteria 2286
85 Ga0123354_10247469 3300010882 Bacteria 1816
86 Ga0466706_027435 3300042599 Bacteria 1700
87 Ga0466706_045487 3300042599 Bacteria 46225
88 Ga0466706_056516 3300042599 Bacteria 19262
89 Ga0466700_136206 3300042600 Bacteria 6703
90 Ga0466707_083062 3300042601 Bacteria 7090
91 Ga0466707_161564 3300042601 Bacteria 10752
92 Ga0466707_243595 3300042601 Bacteria 19927
93 Ga0466716_337513 3300042605 Bacteria 4979
94 Ga0466722_004782 3300042609 Bacteria 5325
95 Ga0466735_096691 3300042624 Bacteria 3494
96 Ga0466730_024175 3300042625 Bacteria 1196
97 Ga0466703_151702 3300042636 Bacteria 27425
98 Ga0466704_249256 3300042643 Bacteria 4672
99 Ga0466709_241178 3300042648 Bacteria 10948
100 Ga0466708_135461 3300042652 Bacteria 17966
101 Ga0466708_219364 3300042652 Bacteria 19223
102 Ga0466725_176145 3300042654 Bacteria 20828
103 JGI24699J35502_11134170 3300002509 Bacteria 43760
104 Ga0466705_080072 3300042612 Bacteria 6630
105 Ga0466705_098329 3300042612 Bacteria 3535
106 Ga0466705_513389 3300042612 Bacteria 1249
107 Ga0466715_142198 3300042616 Bacteria 18676
108 Ga0466715_309498 3300042616 Bacteria 1653
109 Ga0466715_480711 3300042616 Bacteria 22723
110 Ga0466726_030520 3300042619 Bacteria 4818
111 Ga0466726_433746 3300042619 Bacteria 20034
112 Ga0123357_10105389 3300009784 Bacteria 3617
113 Ga0123357_10192259 3300009784 Bacteria 2348
114 Ga0123356_10617196 3300010049 Bacteria 1250
115 Ga0123354_10203287 3300010882 Bacteria 2169
116 Ga0466713_046146 3300042602 Bacteria 21457
117 Ga0466719_397684 3300042606 Bacteria 1500
118 Ga0466722_026149 3300042609 Bacteria 42543
119 Ga0466727_226865 3300042655 Bacteria 3842
120 2227512808 2225789004 Bacteria 693
121 IMNBL1DRAFT_c0000303 3300000062 Bacteria 41914
122 Ga0127522_100011 3300009477 Bacteria 644448
123 Ga0466733_048881 3300042659 Bacteria 1924
124 Ga0466733_169232 3300042659 Unclassified 1271
125 Ga0466705_451695 3300042612 Bacteria 2042
126 Ga0466711_074652 3300042615 Bacteria 14018
127 Ga0466692_105849 3300042591 Bacteria 2420
128 Ga0466692_165801 3300042591 Bacteria 1282
129 Ga0466696_368291 3300042596 Bacteria 2452
130 Ga0123357_10011226 3300009784 Bacteria 11468
131 Ga0123357_10157682 3300009784 Bacteria 2732
132 Ga0123354_10502548 3300010882 Bacteria 944
133 Ga0466701_079535 3300042598 Bacteria 72629
134 Ga0466700_075704 3300042600 Bacteria 26374
135 Ga0466714_028687 3300042603 Bacteria 1375
136 Ga0466716_145207 3300042605 Bacteria 1463
137 Ga0466719_491579 3300042606 Bacteria 7343
138 Ga0466703_019858 3300042636 Bacteria 25850
139 Ga0466703_335745 3300042636 Bacteria 5577
140 Ga0466725_198740 3300042654 Bacteria 1369
141 Ga0466705_041128 3300042612 Bacteria 36311
142 Ga0466715_066493 3300042616 Bacteria 33961
143 Ga0466715_117427 3300042616 Bacteria 8309
144 Ga0466728_176748 3300042620 Bacteria 5808
145 Ga0466729_177579 3300042621 Bacteria 9451
146 Ga0466690_287469 3300042590 Bacteria 1746
147 Ga0466691_036654 3300042593 Bacteria 14964
148 Ga0466696_036365 3300042596 Bacteria 16935
149 Ga0123356_10858064 3300010049 Bacteria 1079
150 Ga0123356_11060295 3300010049 Bacteria 980
151 Ga0123354_10000328 3300010882 Bacteria 44060
152 Ga0466707_022169 3300042601 Bacteria 38620
153 Ga0466707_282942 3300042601 Bacteria 1759
154 Ga0466713_007344 3300042602 Bacteria 13469
155 Ga0466714_010457 3300042603 Bacteria 1142
156 Ga0466735_038852 3300042624 Bacteria 6784
157 Ga0466704_107169 3300042643 Bacteria 11926
158 2227606565 2225789004 Bacteria 2294
159 Ga0466705_338591 3300042612 Bacteria 1022
160 Ga0466711_509002 3300042615 Bacteria 4697
161 Ga0466728_098038 3300042620 Bacteria 10918
162 Ga0466690_385570 3300042590 Bacteria 20353
163 Ga0466690_407203 3300042590 Bacteria 13121
164 Ga0466694_245688 3300042594 Bacteria 1237
165 Ga0466696_040606 3300042596 Bacteria 10155
166 Ga0466701_009475 3300042598 Bacteria 1406
167 Ga0466701_029245 3300042598 Bacteria 16273
168 Ga0466713_140874 3300042602 Bacteria 46073
169 Ga0466703_305950 3300042636 Bacteria 6280
170 Ga0466704_406540 3300042643 Bacteria 3153
171 Ga0466709_102522 3300042648 Bacteria 172874
172 Ga0466708_272774 3300042652 Bacteria 6152
173 Ga0123357_10001255 3300009784 Bacteria 26695

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012854 Ga0160448_109578 Ga0160448_1095784 180
2 3300042619 Ga0466726_295675 Ga0466726_295675_2135_2731 185
3 3300042618 Ga0466723_021356 Ga0466723_021356_228_851 186
4 3300042593 Ga0466691_005883 Ga0466691_005883_2411_2983 190
5 2225789004 2227606565 2228175810 196
6 3300042597 Ga0466699_254412 Ga0466699_254412_1924_2514 196
7 3300042603 Ga0466714_028687 Ga0466714_028687_754_1344 196
8 3300042606 Ga0466719_370215 Ga0466719_370215_5390_5980 196
9 3300042614 Ga0466712_150496 Ga0466712_150496_1837_2427 196
10 3300042616 Ga0466715_020643 Ga0466715_020643_820_1410 196
11 3300042616 Ga0466715_480711 Ga0466715_480711_10286_10876 196
12 3300042643 Ga0466704_442642 Ga0466704_442642_12818_13408 196
13 3300042655 Ga0466727_144340 Ga0466727_144340_1071_1661 196
14 2225789004 2227122482 2227516075 197
15 3300042590 Ga0466690_407203 Ga0466690_407203_220_813 197
16 3300042591 Ga0466692_105849 Ga0466692_105849_730_1323 197
17 3300042593 Ga0466691_036654 Ga0466691_036654_8685_9278 197
18 3300042593 Ga0466691_212540 Ga0466691_212540_1339_1932 197
19 3300042594 Ga0466694_245688 Ga0466694_245688_469_1062 197
20 3300042596 Ga0466696_036365 Ga0466696_036365_8756_9349 197
21 3300042596 Ga0466696_316966 Ga0466696_316966_2317_2910 197
22 3300042598 Ga0466701_009475 Ga0466701_009475_354_947 197
23 3300042598 Ga0466701_079535 Ga0466701_079535_31168_31761 197
24 3300042601 Ga0466707_022169 Ga0466707_022169_3388_3981 197
25 3300042601 Ga0466707_191430 Ga0466707_191430_795_1388 197
26 3300042601 Ga0466707_282942 Ga0466707_282942_449_1042 197
27 3300042602 Ga0466713_007344 Ga0466713_007344_7017_7610 197
28 3300042602 Ga0466713_044454 Ga0466713_044454_1861_2454 197
29 3300042609 Ga0466722_036334 Ga0466722_036334_3643_4236 197
30 3300042610 Ga0466698_266574 Ga0466698_266574_1281_1874 197
31 3300042611 Ga0466697_258751 Ga0466697_258751_196_789 197
32 3300042619 Ga0466726_433746 Ga0466726_433746_13483_14076 197
33 3300042621 Ga0466729_215081 Ga0466729_215081_689_1282 197
34 3300042623 Ga0466734_161395 Ga0466734_161395_124_717 197
35 3300042636 Ga0466703_008757 Ga0466703_008757_254_847 197
36 3300042636 Ga0466703_199268 Ga0466703_199268_329_922 197
37 3300042654 Ga0466725_198740 Ga0466725_198740_757_1350 197
38 3300042655 Ga0466727_229282 Ga0466727_229282_418_1011 197
39 3300042659 Ga0466733_048881 Ga0466733_048881_838_1431 197
40 2225789004 2227512808 2228008634 198
41 3300000062 IMNBL1DRAFT_c0000303 IMNBL1DRAFT_000030313 198
42 3300000062 IMNBL1DRAFT_c0000411 IMNBL1DRAFT_000041126 198
43 3300009784 Ga0123357_10001255 Ga0123357_100012558 198
44 3300009784 Ga0123357_10010972 Ga0123357_100109728 198
45 3300009784 Ga0123357_10157682 Ga0123357_101576824 198
46 3300009784 Ga0123357_10189477 Ga0123357_101894772 198
47 3300009784 Ga0123357_10194820 Ga0123357_101948203 198
48 3300010882 Ga0123354_10005281 Ga0123354_100052816 198
49 3300010882 Ga0123354_10359539 Ga0123354_103595392 198
50 3300042582 Ga0466657_078928 Ga0466657_078928_11068_11664 198
51 3300042593 Ga0466691_058338 Ga0466691_058338_6702_7298 198
52 3300042596 Ga0466696_368291 Ga0466696_368291_91_687 198
53 3300042598 Ga0466701_029245 Ga0466701_029245_3736_4332 198
54 3300042598 Ga0466701_050189 Ga0466701_050189_4628_5224 198
55 3300042600 Ga0466700_075704 Ga0466700_075704_12325_12921 198
56 3300042600 Ga0466700_136206 Ga0466700_136206_5769_6365 198
57 3300042601 Ga0466707_044264 Ga0466707_044264_598_1194 198
58 3300042601 Ga0466707_083062 Ga0466707_083062_1773_2369 198
59 3300042601 Ga0466707_129085 Ga0466707_129085_888_1484 198
60 3300042601 Ga0466707_161564 Ga0466707_161564_2596_3192 198
61 3300042601 Ga0466707_243595 Ga0466707_243595_9678_10274 198
62 3300042602 Ga0466713_099183 Ga0466713_099183_71800_72396 198
63 3300042602 Ga0466713_140874 Ga0466713_140874_17824_18420 198
64 3300042603 Ga0466714_010457 Ga0466714_010457_115_711 198
65 3300042609 Ga0466722_026149 Ga0466722_026149_10741_11337 198
66 3300042612 Ga0466705_080072 Ga0466705_080072_3781_4377 198
67 3300042615 Ga0466711_238034 Ga0466711_238034_2705_3301 198
68 3300042620 Ga0466728_016956 Ga0466728_016956_24322_24918 198
69 3300042620 Ga0466728_098038 Ga0466728_098038_8161_8757 198
70 3300042624 Ga0466735_096691 Ga0466735_096691_1629_2225 198
71 3300042625 Ga0466730_024175 Ga0466730_024175_447_1043 198
72 3300042636 Ga0466703_020799 Ga0466703_020799_20402_20998 198
73 3300042636 Ga0466703_151702 Ga0466703_151702_3474_4070 198
74 3300042636 Ga0466703_179942 Ga0466703_179942_3215_3811 198
75 3300042636 Ga0466703_305950 Ga0466703_305950_2305_2901 198
76 3300042636 Ga0466703_354789 Ga0466703_354789_3707_4303 198
77 3300042643 Ga0466704_249256 Ga0466704_249256_2018_2614 198
78 3300042643 Ga0466704_406540 Ga0466704_406540_134_730 198
79 3300042652 Ga0466708_057780 Ga0466708_057780_290_886 198
80 3300042659 Ga0466733_047834 Ga0466733_047834_39572_40168 198
81 3300042659 Ga0466733_080268 Ga0466733_080268_834_1430 198
82 iso_pr_bacteria 2695420317 2695484812 198
83 iso_pr_bacteria 2820750388 2820751648 198
84 iso_pr_bacteria 2820762746 2820764500 198
85 iso_pr_bacteria 2820778767 2820780690 198
86 iso_pr_bacteria 2873600114 2873603326 198
87 iso_pr_bacteria 2873610414 2873613719 198
88 iso_pr_bacteria 2910926975 2910928698 198
89 iso_pr_bacteria 2910942425 2910946029 198
90 iso_pr_bacteria 2910959314 2910962445 198
91 iso_pr_bacteria 2940205530 2940207697 198
92 iso_pr_bacteria 2940212447 2940214612 198
93 iso_pr_bacteria 2940244548 2940247211 198
94 iso_pr_bacteria 2940248789 2940251095 198
95 iso_pr_bacteria 2940253009 2940255343 198
96 iso_pr_bacteria 2940257232 2940259340 198
97 iso_pr_bacteria 2940298504 2940300666 198
98 iso_pr_bacteria 2940302308 2940304329 198
99 iso_pr_bacteria 2940306115 2940307891 198
100 iso_pr_bacteria 2940309933 2940311846 198
101 iso_pr_bacteria 2940313741 2940315543 198
102 iso_pr_bacteria 2940317558 2940319358 198
103 iso_pr_bacteria 2940321370 2940323603 198
104 iso_pr_bacteria 2940325180 2940327340 198
105 iso_pr_bacteria 2940328985 2940331005 198
106 iso_pr_bacteria 2940332795 2940334595 198
107 iso_pr_bacteria 8100157865 8100161119 198
108 3300002509 JGI24699J35502_11134170 JGI24699J35502_1113417037 199
109 3300002509 JGI24699J35502_11134210 JGI24699J35502_1113421041 199
110 3300009784 Ga0123357_10001078 Ga0123357_100010783 199
111 3300009784 Ga0123357_10105389 Ga0123357_101053893 199
112 3300009784 Ga0123357_10192259 Ga0123357_101922592 199
113 3300009784 Ga0123357_10198963 Ga0123357_101989632 199
114 3300009784 Ga0123357_10290613 Ga0123357_102906132 199
115 3300010049 Ga0123356_10858064 Ga0123356_108580642 199
116 3300010882 Ga0123354_10203287 Ga0123354_102032872 199
117 3300010882 Ga0123354_10247469 Ga0123354_102474693 199
118 3300042590 Ga0466690_287469 Ga0466690_287469_977_1576 199
119 3300042590 Ga0466690_394310 Ga0466690_394310_651_1250 199
120 3300042596 Ga0466696_040606 Ga0466696_040606_2626_3225 199
121 3300042602 Ga0466713_046146 Ga0466713_046146_11182_11781 199
122 3300042602 Ga0466713_078988 Ga0466713_078988_247_846 199
123 3300042605 Ga0466716_129240 Ga0466716_129240_5058_5657 199
124 3300042605 Ga0466716_337513 Ga0466716_337513_2867_3466 199
125 3300042606 Ga0466719_491579 Ga0466719_491579_4999_5598 199
126 3300042609 Ga0466722_004782 Ga0466722_004782_2533_3132 199
127 3300042615 Ga0466711_165558 Ga0466711_165558_949_1548 199
128 3300042615 Ga0466711_234030 Ga0466711_234030_2072_2671 199
129 3300042615 Ga0466711_249317 Ga0466711_249317_12248_12847 199
130 3300042616 Ga0466715_066493 Ga0466715_066493_20470_21069 199
131 3300042616 Ga0466715_117427 Ga0466715_117427_3286_3885 199
132 3300042618 Ga0466723_209820 Ga0466723_209820_1157_1756 199
133 3300042621 Ga0466729_007879 Ga0466729_007879_9734_10333 199
134 3300042624 Ga0466735_038852 Ga0466735_038852_3043_3642 199
135 3300042636 Ga0466703_019858 Ga0466703_019858_103_702 199
136 3300042636 Ga0466703_128842 Ga0466703_128842_9492_10091 199
137 3300042636 Ga0466703_335745 Ga0466703_335745_2120_2719 199
138 3300042648 Ga0466709_102522 Ga0466709_102522_97953_98552 199
139 3300042648 Ga0466709_309968 Ga0466709_309968_2323_2922 199
140 3300042654 Ga0466725_176145 Ga0466725_176145_18285_18884 199
141 3300042659 Ga0466733_169232 Ga0466733_169232_337_936 199
142 iso_pr_bacteria 2910930387 2910932489 199
143 iso_pr_bacteria 8100166142 8100169438 199
144 3300010882 Ga0123354_10004885 Ga0123354_1000488517 200
145 3300010882 Ga0123354_10502548 Ga0123354_105025481 200
146 3300042612 Ga0466705_338591 Ga0466705_338591_299_901 200
147 3300042620 Ga0466728_234203 Ga0466728_234203_395_997 200
148 3300042652 Ga0466708_008222 Ga0466708_008222_4387_4989 200
149 iso_pr_bacteria 2873776654 2873780561 200
150 3300000062 IMNBL1DRAFT_c0005773 IMNBL1DRAFT_00057735 201
151 3300042590 Ga0466690_049656 Ga0466690_049656_5107_5712 201
152 3300042591 Ga0466692_165801 Ga0466692_165801_508_1113 201
153 3300042605 Ga0466716_145207 Ga0466716_145207_23_628 201
154 3300042615 Ga0466711_509002 Ga0466711_509002_3529_4134 201
155 3300042621 Ga0466729_177579 Ga0466729_177579_5858_6463 201
156 iso_pr_bacteria 3004677695 3004679341 201
157 3300042612 Ga0466705_191911 Ga0466705_191911_2378_2986 202
158 3300042616 Ga0466715_194603 Ga0466715_194603_23144_23752 202
159 3300042643 Ga0466704_107169 Ga0466704_107169_6902_7510 202
160 iso_pr_bacteria 2998907766 2998909577 202
161 iso_pr_bacteria 3004667792 3004668987 202
162 3300042599 Ga0466706_027435 Ga0466706_027435_365_976 203
163 3300042599 Ga0466706_045487 Ga0466706_045487_37981_38592 203
164 3300042599 Ga0466706_056516 Ga0466706_056516_3619_4230 203
165 3300042599 Ga0466706_212921 Ga0466706_212921_16291_16902 203
166 3300042602 Ga0466713_035110 Ga0466713_035110_277_888 203
167 3300042624 Ga0466735_044121 Ga0466735_044121_103_714 203
168 3300042624 Ga0466735_071826 Ga0466735_071826_1233_1844 203
169 3300042624 Ga0466735_112599 Ga0466735_112599_5256_5867 203
170 3300042624 Ga0466735_160562 Ga0466735_160562_1162_1773 203
171 iso_pr_bacteria 2609459943 2610744243 203
172 iso_pr_bacteria 2830041218 2830045175 203
173 iso_pr_bacteria 2922326829 2922328454 203
174 3300005083 Ga0068305_10010571 Ga0068305_1001057154 204
175 3300042590 Ga0466690_385570 Ga0466690_385570_13420_14034 204
176 3300042593 Ga0466691_052189 Ga0466691_052189_3375_3989 204
177 3300042599 Ga0466706_280127 Ga0466706_280127_1603_2217 204
178 3300042605 Ga0466716_471390 Ga0466716_471390_2551_3165 204
179 3300042606 Ga0466719_397684 Ga0466719_397684_560_1174 204
180 3300042616 Ga0466715_142198 Ga0466715_142198_6823_7437 204
181 3300042619 Ga0466726_030520 Ga0466726_030520_383_997 204
182 3300042620 Ga0466728_019567 Ga0466728_019567_25336_25950 204
183 3300042648 Ga0466709_241178 Ga0466709_241178_3475_4089 204
184 3300042652 Ga0466708_135461 Ga0466708_135461_9426_10040 204
185 3300042652 Ga0466708_272774 Ga0466708_272774_1855_2469 204
186 3300042655 Ga0466727_226865 Ga0466727_226865_2073_2687 204
187 3300042655 Ga0466727_287969 Ga0466727_287969_2600_3214 204
188 iso_pr_bacteria 3004672520 3004675700 204
189 3300007085 Ga0104045_1075598 Ga0104045_10755982 205
190 3300009477 Ga0127522_100011 Ga0127522_100011351 205
191 3300042599 Ga0466706_252336 Ga0466706_252336_23295_23912 205
192 3300042643 Ga0466704_433307 Ga0466704_433307_149_766 205
193 iso_pr_bacteria 2820759988 2820761400 205
194 3300042599 Ga0466706_058332 Ga0466706_058332_7209_7829 206
195 3300042620 Ga0466728_176748 Ga0466728_176748_4918_5538 206
196 3300009784 Ga0123357_10011226 Ga0123357_100112266 207
197 3300010049 Ga0123356_10617196 Ga0123356_106171961 207
198 3300012803 Ga0160465_100068 Ga0160465_10006822 207
199 3300042652 Ga0466708_219364 Ga0466708_219364_7868_8491 207
200 3300042612 Ga0466705_451695 Ga0466705_451695_293_919 208
201 3300010049 Ga0123356_11060295 Ga0123356_110602952 209
202 3300038942 Ga0120204_000112 Ga0120204_000112_825_1454 209
203 3300042606 Ga0466719_206932 Ga0466719_206932_285_914 209
204 3300042615 Ga0466711_074652 Ga0466711_074652_7621_8256 211
205 3300010882 Ga0123354_10000328 Ga0123354_1000032829 213
206 iso_pr_bacteria 2558860194 2559121791 213
207 iso_pr_bacteria 2558860195 2559122401 213
208 iso_pr_bacteria 2558860196 2559123015 213
209 iso_pr_bacteria 2558860197 2559123623 213
210 3300042615 Ga0466711_384472 Ga0466711_384472_576_1220 214
211 3300042612 Ga0466705_041128 Ga0466705_041128_19907_20575 222
212 3300042612 Ga0466705_098329 Ga0466705_098329_261_947 228
213 3300042612 Ga0466705_513389 Ga0466705_513389_211_897 228
214 3300042616 Ga0466715_309498 Ga0466715_309498_632_1324 230

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01502 PRA-CH Phosphoribosyl-AMP cyclohydrolase 59 131 0.99
PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase 144 229 0.97

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.