Protein Family IF07714
Metagenome
Isolate
127
Members
67
Samples
115
Scaffolds
239.57
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_233135|Ga0466715_233135_5310_6122
- Length
- 270 aa
- Sequence
- MRATATVPRTIAVPVATVAAPDPVMRRHMLDNIFLEDILFLDIETVPQAFGLDKLDEISRRLWEDKAAVFCKDGQTPADVYGRAGIYAEFGKIICISVGFLYRTDETWALRLKSCFGENEKDLLLEFSETVAKFARQHNTLLCAHNGKEFDFPYIARRMLINGIRLPAVIDVAGKKPWEVPFLDTMELWSFGDRKNYTSLKLLAHVFDIPSPKDDIDGSQVAEIFWKEKDLLRIVRYCEKXXLTIARLLLRYKGLPTIPPEMISSSTIFG
Sample Types
Isolate
9.4%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.1%
Kalotermitidae
23.0%
Formicidae
6.6%
Drosophilidae
4.9%
Termopsidae
4.9%
Unclassified
4.9%
Passalidae
3.3%
Elmidae
3.3%
Rhinotermitidae
3.3%
Hodotermitidae
1.6%
Nephropidae
1.6%
Cambaridae
1.6%
Kiwaidae
1.6%
Daphniidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 2 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 7 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 8 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 9 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 27 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 28 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 29 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 40 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 45 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 46 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 47 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 48 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 49 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 50 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 51 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 52 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 53 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 54 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 55 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 56 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 63 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 64 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 65 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 66 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 67 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10262814 | 3300009826 | Bacteria | 2411 |
| 2 | Ga0466715_224461 | 3300042616 | Bacteria | 9732 |
| 3 | Ga0264413_151565 | 3300024493 | Bacteria | 2972 |
| 4 | Ga0466657_229008 | 3300042582 | Bacteria | 97233 |
| 5 | Ga0466703_069735 | 3300042636 | Bacteria | 16372 |
| 6 | Ga0466727_187680 | 3300042655 | Bacteria | 7551 |
| 7 | Ga0466722_116297 | 3300042609 | Bacteria | 4889 |
| 8 | JGI24702J35022_10091411 | 3300002462 | Bacteria | 1657 |
| 9 | JGI24702J35022_10128692 | 3300002462 | Bacteria | 1404 |
| 10 | JGI24702J35022_10197635 | 3300002462 | Bacteria | 1149 |
| 11 | Ga0102736_1000068 | 3300007052 | Bacteria | 53396 |
| 12 | Ga0466733_044214 | 3300042659 | Bacteria | 11555 |
| 13 | Ga0123356_10760607 | 3300010049 | Bacteria | 1139 |
| 14 | Ga0123356_10845171 | 3300010049 | Bacteria | 1087 |
| 15 | Ga0123353_10426389 | 3300010167 | Bacteria | 1963 |
| 16 | Ga0466728_104542 | 3300042620 | Bacteria | 2221 |
| 17 | Ga0466657_354304 | 3300042582 | Bacteria | 1000 |
| 18 | Ga0466695_340885 | 3300042595 | Bacteria | 2868 |
| 19 | Ga0466735_132899 | 3300042624 | Bacteria | 5027 |
| 20 | Ga0466730_084503 | 3300042625 | Bacteria | 1429 |
| 21 | Ga0466709_184405 | 3300042648 | Bacteria | 30874 |
| 22 | Ga0466708_398853 | 3300042652 | Bacteria | 19626 |
| 23 | Ga0466707_067509 | 3300042601 | Bacteria | 6900 |
| 24 | Ga0466714_138540 | 3300042603 | Bacteria | 27343 |
| 25 | Ga0466716_262441 | 3300042605 | Bacteria | 5674 |
| 26 | Ga0466719_536637 | 3300042606 | Bacteria | 1229 |
| 27 | JGI24702J35022_10028528 | 3300002462 | Bacteria | 2998 |
| 28 | Ga0466733_166572 | 3300042659 | Bacteria | 14258 |
| 29 | Ga0466711_363285 | 3300042615 | Bacteria | 32228 |
| 30 | Ga0466715_233135 | 3300042616 | Bacteria | 16848 |
| 31 | Ga0157631_124153 | 3300013007 | Bacteria | 5030 |
| 32 | Ga0466656_276859 | 3300042550 | Bacteria | 1485 |
| 33 | Ga0466696_004307 | 3300042596 | Bacteria | 3753 |
| 34 | Ga0466735_200100 | 3300042624 | Bacteria | 1674 |
| 35 | Ga0466727_063819 | 3300042655 | Bacteria | 4244 |
| 36 | Ga0466701_050423 | 3300042598 | Bacteria | 264361 |
| 37 | Ga0466701_064388 | 3300042598 | Bacteria | 1320 |
| 38 | Ga0466706_038976 | 3300042599 | Bacteria | 24610 |
| 39 | Ga0466706_102931 | 3300042599 | Bacteria | 7666 |
| 40 | Ga0466707_117545 | 3300042601 | Bacteria | 11233 |
| 41 | Ga0466714_013068 | 3300042603 | Bacteria | 2618 |
| 42 | Ga0466719_429284 | 3300042606 | Bacteria | 1297 |
| 43 | Ga0466722_267989 | 3300042609 | Bacteria | 2689 |
| 44 | IMNBL1DRAFT_c0027403 | 3300000062 | Bacteria | 2143 |
| 45 | Ga0072940_1099628 | 3300005200 | Bacteria | 3486 |
| 46 | Ga0123357_10099942 | 3300009784 | Bacteria | 3743 |
| 47 | Ga0123354_10174547 | 3300010882 | Bacteria | 2484 |
| 48 | Ga0466711_035584 | 3300042615 | Bacteria | 18685 |
| 49 | Ga0466715_098507 | 3300042616 | Bacteria | 24113 |
| 50 | Ga0466728_167684 | 3300042620 | Bacteria | 1332 |
| 51 | Ga0466696_087909 | 3300042596 | Bacteria | 9563 |
| 52 | Ga0466704_090178 | 3300042643 | Bacteria | 23929 |
| 53 | Ga0466709_070059 | 3300042648 | Bacteria | 19387 |
| 54 | Ga0466701_055630 | 3300042598 | Unclassified | 1225 |
| 55 | Ga0466722_051152 | 3300042609 | Bacteria | 5390 |
| 56 | Ga0102739_1000011 | 3300007095 | Bacteria | 63975 |
| 57 | Ga0103267_1000071 | 3300007190 | Bacteria | 38177 |
| 58 | Ga0103267_1000166 | 3300007190 | Bacteria | 25917 |
| 59 | Ga0466697_275042 | 3300042611 | Bacteria | 1571 |
| 60 | Ga0123356_10554763 | 3300010049 | Bacteria | 1310 |
| 61 | Ga0123353_10072506 | 3300010167 | Bacteria | 5534 |
| 62 | Ga0123353_10113344 | 3300010167 | Bacteria | 4365 |
| 63 | Ga0466723_135882 | 3300042618 | Bacteria | 78165 |
| 64 | Ga0466714_058436 | 3300042603 | Bacteria | 50482 |
| 65 | IMNBL1DRAFT_c0014540 | 3300000062 | Bacteria | 3466 |
| 66 | Ga0104050_1027598 | 3300007153 | Unclassified | 1821 |
| 67 | Ga0103268_1000173 | 3300007192 | Bacteria | 21119 |
| 68 | Ga0466733_144976 | 3300042659 | Bacteria | 11379 |
| 69 | Ga0466705_457675 | 3300042612 | Bacteria | 39622 |
| 70 | Ga0466690_419906 | 3300042590 | Bacteria | 3999 |
| 71 | Ga0466703_269606 | 3300042636 | Bacteria | 7729 |
| 72 | Ga0466709_185660 | 3300042648 | Bacteria | 43932 |
| 73 | Ga0466700_101795 | 3300042600 | Bacteria | 1023 |
| 74 | Ga0466722_116433 | 3300042609 | Bacteria | 4777 |
| 75 | 2227479363 | 2225789004 | Bacteria | 4498 |
| 76 | Ga0466733_092628 | 3300042659 | Bacteria | 5283 |
| 77 | Ga0466733_190275 | 3300042659 | Bacteria | 18255 |
| 78 | Ga0466715_008550 | 3300042616 | Bacteria | 39825 |
| 79 | Ga0466726_032617 | 3300042619 | Bacteria | 4891 |
| 80 | Ga0466726_238211 | 3300042619 | Bacteria | 2139 |
| 81 | Ga0466729_178582 | 3300042621 | Bacteria | 15596 |
| 82 | Ga0466690_187604 | 3300042590 | Bacteria | 1536 |
| 83 | Ga0466691_204801 | 3300042593 | Bacteria | 98819 |
| 84 | Ga0466696_197304 | 3300042596 | Bacteria | 4028 |
| 85 | Ga0466734_017117 | 3300042623 | Bacteria | 1898 |
| 86 | Ga0466725_419383 | 3300042654 | Bacteria | 2398 |
| 87 | Ga0466701_071394 | 3300042598 | Bacteria | 38887 |
| 88 | Ga0466707_352912 | 3300042601 | Bacteria | 8824 |
| 89 | Ga0466714_033894 | 3300042603 | Bacteria | 61713 |
| 90 | Ga0466719_048872 | 3300042606 | Bacteria | 1683 |
| 91 | IMNBL1DRAFT_c0000476 | 3300000062 | Bacteria | 33531 |
| 92 | JGI24699J35502_11133861 | 3300002509 | Bacteria | 17399 |
| 93 | JGI24696J40584_12960899 | 3300002834 | Bacteria | 9170 |
| 94 | Ga0072940_1099627 | 3300005200 | Bacteria | 908 |
| 95 | Ga0104048_1000684 | 3300007143 | Bacteria | 23236 |
| 96 | Ga0104048_1002755 | 3300007143 | Bacteria | 5183 |
| 97 | Ga0123354_10004397 | 3300010882 | Bacteria | 19955 |
| 98 | Ga0123354_10271018 | 3300010882 | Bacteria | 1671 |
| 99 | Ga0466715_031266 | 3300042616 | Bacteria | 10063 |
| 100 | Ga0466715_645221 | 3300042616 | Bacteria | 7850 |
| 101 | Ga0466723_040839 | 3300042618 | Bacteria | 20873 |
| 102 | Ga0466726_288688 | 3300042619 | Bacteria | 30753 |
| 103 | Ga0466728_059911 | 3300042620 | Bacteria | 1674 |
| 104 | Ga0466690_240026 | 3300042590 | Bacteria | 6801 |
| 105 | Ga0466691_224837 | 3300042593 | Bacteria | 24037 |
| 106 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 107 | Ga0466698_185181 | 3300042610 | Bacteria | 2031 |
| 108 | 2227086375 | 2225789004 | Bacteria | 9943 |
| 109 | JGI24702J35022_10308838 | 3300002462 | Bacteria | 935 |
| 110 | Ga0072941_1083339 | 3300005201 | Bacteria | 15001 |
| 111 | Ga0104019_1003343 | 3300007150 | Unclassified | 2306 |
| 112 | Ga0104019_1031108 | 3300007150 | Unclassified | 2906 |
| 113 | Ga0104019_1192998 | 3300007150 | Bacteria | 1519 |
| 114 | Ga0104050_1016439 | 3300007153 | Bacteria | 1826 |
| 115 | Ga0103267_1000157 | 3300007190 | Bacteria | 37935 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007150 | Ga0104019_1003343 | Ga0104019_10033435 | 199 |
| 2 | 3300007150 | Ga0104019_1031108 | Ga0104019_10311083 | 219 |
| 3 | 3300042598 | Ga0466701_050423 | Ga0466701_050423_117362_118075 | 220 |
| 4 | 3300042603 | Ga0466714_033894 | Ga0466714_033894_52746_53477 | 225 |
| 5 | iso_pr_bacteria | 2820750388 | 2820751717 | 225 |
| 6 | 3300000062 | IMNBL1DRAFT_c0027403 | IMNBL1DRAFT_00274033 | 226 |
| 7 | 3300005200 | Ga0072940_1099627 | Ga0072940_10996271 | 228 |
| 8 | 3300007052 | Ga0102736_1000068 | Ga0102736_100006836 | 231 |
| 9 | 3300042611 | Ga0466697_275042 | Ga0466697_275042_762_1487 | 231 |
| 10 | 3300042596 | Ga0466696_197304 | Ga0466696_197304_209_910 | 233 |
| 11 | 3300042618 | Ga0466723_040839 | Ga0466723_040839_15332_16033 | 233 |
| 12 | iso_pr_bacteria | 2718218155 | 2720328435 | 233 |
| 13 | 3300042609 | Ga0466722_116297 | Ga0466722_116297_3958_4662 | 234 |
| 14 | 3300042648 | Ga0466709_184405 | Ga0466709_184405_21708_22412 | 234 |
| 15 | 3300042655 | Ga0466727_187680 | Ga0466727_187680_1440_2144 | 234 |
| 16 | 3300042659 | Ga0466733_092628 | Ga0466733_092628_1248_1952 | 234 |
| 17 | 3300002462 | JGI24702J35022_10128692 | JGI24702J35022_101286922 | 235 |
| 18 | 3300042590 | Ga0466690_187604 | Ga0466690_187604_368_1075 | 235 |
| 19 | 3300042599 | Ga0466706_102931 | Ga0466706_102931_165_872 | 235 |
| 20 | 3300042615 | Ga0466711_363285 | Ga0466711_363285_2411_3118 | 235 |
| 21 | 3300042616 | Ga0466715_098507 | Ga0466715_098507_15472_16179 | 235 |
| 22 | 3300042652 | Ga0466708_398853 | Ga0466708_398853_4189_4896 | 235 |
| 23 | 3300042606 | Ga0466719_048872 | Ga0466719_048872_102_812 | 236 |
| 24 | 2225789004 | 2227086375 | 2227463255 | 237 |
| 25 | 2225789004 | 2227479363 | 2227935682 | 237 |
| 26 | 3300000062 | IMNBL1DRAFT_c0014540 | IMNBL1DRAFT_00145402 | 237 |
| 27 | 3300002462 | JGI24702J35022_10308838 | JGI24702J35022_103088381 | 237 |
| 28 | 3300007190 | Ga0103267_1000071 | Ga0103267_100007127 | 237 |
| 29 | 3300042598 | Ga0466701_071394 | Ga0466701_071394_11880_12593 | 237 |
| 30 | 3300042605 | Ga0466716_262441 | Ga0466716_262441_4673_5386 | 237 |
| 31 | 3300042609 | Ga0466722_267989 | Ga0466722_267989_1116_1829 | 237 |
| 32 | 3300042612 | Ga0466705_457675 | Ga0466705_457675_10343_11056 | 237 |
| 33 | 3300042619 | Ga0466726_032617 | Ga0466726_032617_3708_4421 | 237 |
| 34 | 3300042620 | Ga0466728_059911 | Ga0466728_059911_99_812 | 237 |
| 35 | 3300042636 | Ga0466703_069735 | Ga0466703_069735_2354_3067 | 237 |
| 36 | 3300042643 | Ga0466704_090178 | Ga0466704_090178_18053_18766 | 237 |
| 37 | 3300042648 | Ga0466709_070059 | Ga0466709_070059_985_1698 | 237 |
| 38 | 3300042649 | Ga0466724_23916 | Ga0466724_23916_307822_308535 | 237 |
| 39 | iso_pr_bacteria | 2811995047 | 2812947055 | 237 |
| 40 | iso_pr_bacteria | 2838772460 | 2838774097 | 237 |
| 41 | iso_pr_bacteria | 2864878056 | 2864878419 | 237 |
| 42 | iso_pr_bacteria | 2864886855 | 2864887895 | 237 |
| 43 | iso_pr_bacteria | 2882250448 | 2882253476 | 237 |
| 44 | 3300000062 | IMNBL1DRAFT_c0000476 | IMNBL1DRAFT_000047622 | 238 |
| 45 | 3300007095 | Ga0102739_1000011 | Ga0102739_100001139 | 238 |
| 46 | 3300007143 | Ga0104048_1000684 | Ga0104048_100068425 | 238 |
| 47 | 3300007143 | Ga0104048_1002755 | Ga0104048_10027553 | 238 |
| 48 | 3300007150 | Ga0104019_1192998 | Ga0104019_11929982 | 238 |
| 49 | 3300007153 | Ga0104050_1016439 | Ga0104050_10164392 | 238 |
| 50 | 3300007153 | Ga0104050_1027598 | Ga0104050_10275982 | 238 |
| 51 | 3300013007 | Ga0157631_124153 | Ga0157631_1241533 | 238 |
| 52 | 3300024493 | Ga0264413_151565 | Ga0264413_1515651 | 238 |
| 53 | 3300042593 | Ga0466691_204801 | Ga0466691_204801_65516_66232 | 238 |
| 54 | 3300042603 | Ga0466714_013068 | Ga0466714_013068_1640_2356 | 238 |
| 55 | 3300042659 | Ga0466733_144976 | Ga0466733_144976_8789_9505 | 238 |
| 56 | iso_pr_bacteria | 2820757377 | 2820757917 | 238 |
| 57 | 3300002462 | JGI24702J35022_10197635 | JGI24702J35022_101976351 | 239 |
| 58 | 3300002509 | JGI24699J35502_11133861 | JGI24699J35502_111338613 | 239 |
| 59 | 3300005200 | Ga0072940_1099628 | Ga0072940_10996282 | 239 |
| 60 | 3300005201 | Ga0072941_1083339 | Ga0072941_108333912 | 239 |
| 61 | 3300010882 | Ga0123354_10174547 | Ga0123354_101745472 | 239 |
| 62 | 3300042636 | Ga0466703_269606 | Ga0466703_269606_2273_2992 | 239 |
| 63 | iso_pr_bacteria | 2904728850 | 2904731342 | 239 |
| 64 | iso_pr_bacteria | 2958471994 | 2958474464 | 239 |
| 65 | 3300042582 | Ga0466657_229008 | Ga0466657_229008_84877_85599 | 240 |
| 66 | 3300042659 | Ga0466733_166572 | Ga0466733_166572_3861_4583 | 240 |
| 67 | 3300042659 | Ga0466733_190275 | Ga0466733_190275_15608_16330 | 240 |
| 68 | iso_pr_bacteria | 2899132286 | 2899132927 | 240 |
| 69 | 3300002462 | JGI24702J35022_10028528 | JGI24702J35022_100285282 | 241 |
| 70 | 3300042550 | Ga0466656_276859 | Ga0466656_276859_633_1358 | 241 |
| 71 | 3300042582 | Ga0466657_354304 | Ga0466657_354304_252_977 | 241 |
| 72 | 3300042590 | Ga0466690_240026 | Ga0466690_240026_225_950 | 241 |
| 73 | 3300042598 | Ga0466701_055630 | Ga0466701_055630_484_1209 | 241 |
| 74 | 3300042598 | Ga0466701_064388 | Ga0466701_064388_100_825 | 241 |
| 75 | 3300042601 | Ga0466707_067509 | Ga0466707_067509_852_1577 | 241 |
| 76 | 3300042603 | Ga0466714_058436 | Ga0466714_058436_31010_31735 | 241 |
| 77 | 3300042623 | Ga0466734_017117 | Ga0466734_017117_122_847 | 241 |
| 78 | 3300042654 | Ga0466725_419383 | Ga0466725_419383_716_1441 | 241 |
| 79 | 3300007190 | Ga0103267_1000166 | Ga0103267_10001667 | 242 |
| 80 | 3300010049 | Ga0123356_10554763 | Ga0123356_105547631 | 242 |
| 81 | 3300010049 | Ga0123356_10845171 | Ga0123356_108451712 | 242 |
| 82 | 3300010167 | Ga0123353_10426389 | Ga0123353_104263892 | 242 |
| 83 | 3300042590 | Ga0466690_419906 | Ga0466690_419906_1533_2261 | 242 |
| 84 | 3300042593 | Ga0466691_224837 | Ga0466691_224837_11757_12485 | 242 |
| 85 | 3300042599 | Ga0466706_038976 | Ga0466706_038976_15450_16178 | 242 |
| 86 | 3300042601 | Ga0466707_117545 | Ga0466707_117545_7218_7946 | 242 |
| 87 | 3300042616 | Ga0466715_645221 | Ga0466715_645221_3936_4664 | 242 |
| 88 | 3300007192 | Ga0103268_1000173 | Ga0103268_100017318 | 243 |
| 89 | 3300009826 | Ga0123355_10262814 | Ga0123355_102628141 | 243 |
| 90 | 3300010882 | Ga0123354_10004397 | Ga0123354_100043973 | 243 |
| 91 | 3300010882 | Ga0123354_10271018 | Ga0123354_102710184 | 243 |
| 92 | 3300042596 | Ga0466696_004307 | Ga0466696_004307_2407_3138 | 243 |
| 93 | 3300042609 | Ga0466722_116433 | Ga0466722_116433_3770_4501 | 243 |
| 94 | 3300042616 | Ga0466715_008550 | Ga0466715_008550_3081_3812 | 243 |
| 95 | 3300042620 | Ga0466728_104542 | Ga0466728_104542_1335_2066 | 243 |
| 96 | 3300042620 | Ga0466728_167684 | Ga0466728_167684_154_885 | 243 |
| 97 | 3300042624 | Ga0466735_200100 | Ga0466735_200100_720_1451 | 243 |
| 98 | 3300042648 | Ga0466709_185660 | Ga0466709_185660_17301_18032 | 243 |
| 99 | 3300002462 | JGI24702J35022_10091411 | JGI24702J35022_100914111 | 244 |
| 100 | 3300009784 | Ga0123357_10099942 | Ga0123357_100999423 | 244 |
| 101 | 3300010167 | Ga0123353_10072506 | Ga0123353_100725068 | 244 |
| 102 | 3300010167 | Ga0123353_10113344 | Ga0123353_101133444 | 244 |
| 103 | 3300042595 | Ga0466695_340885 | Ga0466695_340885_2000_2734 | 244 |
| 104 | 3300042596 | Ga0466696_087909 | Ga0466696_087909_6069_6803 | 244 |
| 105 | 3300042606 | Ga0466719_536637 | Ga0466719_536637_113_847 | 244 |
| 106 | 3300042615 | Ga0466711_035584 | Ga0466711_035584_3204_3938 | 244 |
| 107 | 3300042616 | Ga0466715_224461 | Ga0466715_224461_8049_8783 | 244 |
| 108 | 3300042618 | Ga0466723_135882 | Ga0466723_135882_5069_5803 | 244 |
| 109 | 3300042625 | Ga0466730_084503 | Ga0466730_084503_645_1379 | 244 |
| 110 | 3300002834 | JGI24696J40584_12960899 | JGI24696J40584_129608999 | 245 |
| 111 | 3300007190 | Ga0103267_1000157 | Ga0103267_100015737 | 245 |
| 112 | 3300010049 | Ga0123356_10760607 | Ga0123356_107606072 | 245 |
| 113 | 3300042603 | Ga0466714_138540 | Ga0466714_138540_13638_14375 | 245 |
| 114 | 3300042609 | Ga0466722_051152 | Ga0466722_051152_2764_3501 | 245 |
| 115 | 3300042616 | Ga0466715_031266 | Ga0466715_031266_8406_9143 | 245 |
| 116 | 3300042619 | Ga0466726_238211 | Ga0466726_238211_182_919 | 245 |
| 117 | 3300042619 | Ga0466726_288688 | Ga0466726_288688_930_1667 | 245 |
| 118 | 3300042655 | Ga0466727_063819 | Ga0466727_063819_2451_3188 | 245 |
| 119 | 3300042606 | Ga0466719_429284 | Ga0466719_429284_361_1101 | 246 |
| 120 | 3300042624 | Ga0466735_132899 | Ga0466735_132899_880_1620 | 246 |
| 121 | 3300042659 | Ga0466733_044214 | Ga0466733_044214_7150_7893 | 247 |
| 122 | 3300042621 | Ga0466729_178582 | Ga0466729_178582_7501_8289 | 248 |
| 123 | iso_pr_bacteria | 2509276035 | 2509458002 | 248 |
| 124 | 3300042610 | Ga0466698_185181 | Ga0466698_185181_1103_1867 | 254 |
| 125 | 3300042601 | Ga0466707_352912 | Ga0466707_352912_284_1072 | 262 |
| 126 | 3300042600 | Ga0466700_101795 | Ga0466700_101795_166_957 | 263 |
| 127 | 3300042616 | Ga0466715_233135 | Ga0466715_233135_5310_6122 | 270 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.