Protein Family IF07701

Metagenome Isolate
117 Members
41 Samples
114 Scaffolds
426.42 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_204293|Ga0466715_204293_36521_37957
Length
478 aa
Sequence
MKKMRFQKEYTAHGMILRIEFRVKRFKNSKTQRFSTGALRVLMNRFIPRSVCLARLRTVAAMFCLCVAPVLAQTDFDTYFEAKSLRVDFALSGNTFTQSAALQQLREEPVWGGPVKNLTDTFGYGGYYIRAFDGETGNLIYSRGFNTLFEEWRTTDQAKTETQSWTNSISVPYPKKAIVLELLARDRASNLFSPLMRLDVDPESIYIDRSPLKDLTAEKIHYRGDPAGKVDLVFVPEGYTAAEMDKFGKDAARFARALFETPPYDTRQDDFNIWAVRLPSEESGVDISGKDIFKNTALNAGFYTFGIERYLTTADMKSIRDAVWNVPCDAIFVLVNSEIYGGGGMYNFYAVGTADNPRTIRVFVHELGHSFAGLADEYFQSEVAYNDFYNLELEPWEPNITTLVDFASKWQDMLSPGTPVPTPAEAPYIDGTGVFEGGGYVAKGIYRPVDHCTMRDMAPFCPVCRRAILRMIDFVADK

📊 Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.0%
Kalotermitidae 35.0%
Unclassified 12.5%
Termopsidae 10.0%
Rhinotermitidae 5.0%
Blattidae 2.5%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
11 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
12 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
33 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_103178 3300042659 Bacteria 47494
2 Ga0466693_291239 3300042592 Bacteria 1445
3 Ga0068305_10067023 3300005083 Bacteria 9990
4 Ga0466719_114910 3300042606 Bacteria 6897
5 Ga0466719_311757 3300042606 Bacteria 8779
6 Ga0466719_459978 3300042606 Bacteria 14509
7 Ga0466722_148571 3300042609 Bacteria 6571
8 Ga0466710_171695 3300042613 Bacteria 2425
9 Ga0466715_131385 3300042616 Bacteria 16627
10 Ga0466723_012980 3300042618 Bacteria 6563
11 Ga0466723_311194 3300042618 Bacteria 4989
12 Ga0466735_024733 3300042624 Bacteria 2923
13 Ga0466703_115609 3300042636 Bacteria 6164
14 Ga0466703_344027 3300042636 Bacteria 12646
15 Ga0466708_063661 3300042652 Bacteria 27030
16 Ga0466725_072069 3300042654 Bacteria 9691
17 Ga0466727_344797 3300042655 Bacteria 17390
18 Ga0466690_283372 3300042590 Bacteria 11763
19 Ga0466692_022629 3300042591 Bacteria 1521
20 Ga0123353_10012947 3300010167 Bacteria 11911
21 Ga0123353_10532251 3300010167 Bacteria 1701
22 Ga0466716_444952 3300042605 Bacteria 2678
23 Ga0466722_112533 3300042609 Bacteria 4391
24 Ga0466711_041848 3300042615 Bacteria 64215
25 Ga0466723_053892 3300042618 Bacteria 17524
26 Ga0466726_124574 3300042619 Bacteria 4365
27 Ga0466728_190351 3300042620 Unclassified 1456
28 Ga0466728_262920 3300042620 Bacteria 3054
29 Ga0466731_200613 3300042622 Bacteria 2326
30 Ga0466704_447782 3300042643 Bacteria 55110
31 Ga0466709_053672 3300042648 Bacteria 5586
32 Ga0466705_070881 3300042612 Bacteria 9514
33 Ga0466733_206935 3300042659 Bacteria 7267
34 JGI24705J35276_12228529 3300002504 Bacteria 3203
35 Ga0068302_10068579 3300005071 Bacteria 3351
36 Ga0068302_10077706 3300005071 Bacteria 2701
37 Ga0123353_10084233 3300010167 Bacteria 5118
38 Ga0123354_10133336 3300010882 Bacteria 3123
39 Ga0466701_102053 3300042598 Bacteria 13619
40 Ga0466716_199526 3300042605 Bacteria 3089
41 Ga0466735_033038 3300042624 Bacteria 3500
42 Ga0466703_008369 3300042636 Bacteria 8581
43 Ga0466703_045360 3300042636 Bacteria 7673
44 Ga0466705_024738 3300042612 Bacteria 3160
45 Ga0466690_240583 3300042590 Bacteria 1732
46 Ga0466696_112512 3300042596 Bacteria 1991
47 Ga0466716_353124 3300042605 Bacteria 11196
48 Ga0466715_020762 3300042616 Bacteria 43125
49 Ga0466723_346543 3300042618 Bacteria 25857
50 Ga0466728_033548 3300042620 Bacteria 22918
51 Ga0466703_088847 3300042636 Unclassified 1948
52 Ga0466703_355333 3300042636 Bacteria 21860
53 Ga0466705_268544 3300042612 Bacteria 4986
54 Ga0466696_165558 3300042596 Bacteria 2389
55 Ga0466696_300579 3300042596 Bacteria 11220
56 Ga0123353_10001375 3300010167 Bacteria 29812
57 Ga0466717_287034 3300042604 Bacteria 9167
58 Ga0466716_206999 3300042605 Bacteria 3723
59 Ga0466715_204293 3300042616 Bacteria 67582
60 Ga0466723_074619 3300042618 Bacteria 22019
61 Ga0466703_029336 3300042636 Bacteria 13623
62 Ga0466704_047730 3300042643 Bacteria 2796
63 Ga0466704_407939 3300042643 Bacteria 23152
64 Ga0466727_044570 3300042655 Bacteria 5949
65 Ga0466733_018444 3300042659 Bacteria 3365
66 Ga0466696_138955 3300042596 Bacteria 6003
67 JGI24705J35276_12231493 3300002504 Bacteria 3961
68 Ga0123356_10002017 3300010049 Bacteria 21929
69 Ga0123353_10218915 3300010167 Bacteria 2979
70 Ga0466713_048475 3300042602 Bacteria 59892
71 Ga0466713_084245 3300042602 Bacteria 6386
72 Ga0466719_295296 3300042606 Bacteria 15392
73 Ga0466711_165120 3300042615 Bacteria 29551
74 Ga0466715_634006 3300042616 Bacteria 8502
75 Ga0466704_150481 3300042643 Bacteria 22214
76 Ga0466708_032710 3300042652 Bacteria 29431
77 Ga0466705_252899 3300042612 Bacteria 28436
78 Ga0466690_064225 3300042590 Bacteria 9899
79 Ga0068305_10035606 3300005083 Bacteria 5810
80 Ga0068305_10046159 3300005083 Unclassified 8739
81 Ga0123356_10180296 3300010049 Bacteria 2133
82 Ga0123353_10024733 3300010167 Bacteria 9126
83 Ga0123353_10525625 3300010167 Bacteria 1715
84 Ga0466719_071014 3300042606 Bacteria 1625
85 Ga0466719_287942 3300042606 Bacteria 8684
86 Ga0466721_137594 3300042608 Bacteria 9641
87 Ga0466723_042738 3300042618 Bacteria 46355
88 Ga0466726_126983 3300042619 Unclassified 4447
89 Ga0466704_226341 3300042643 Bacteria 22338
90 Ga0466709_005524 3300042648 Bacteria 140810
91 Ga0466709_203956 3300042648 Bacteria 13286
92 Ga0466725_364926 3300042654 Bacteria 15487
93 Ga0466727_168552 3300042655 Bacteria 7401
94 Ga0466705_314339 3300042612 Bacteria 10220
95 Ga0466733_203606 3300042659 Bacteria 45615
96 Ga0466690_164485 3300042590 Bacteria 6673
97 Ga0466692_203219 3300042591 Bacteria 12694
98 Ga0466691_139689 3300042593 Bacteria 10329
99 Ga0466701_009508 3300042598 Bacteria 8398
100 JGI24702J35022_10001450 3300002462 Bacteria 14757
101 JGI24702J35022_10019421 3300002462 Bacteria 3695
102 JGI24696J40584_12959428 3300002834 Bacteria 5112
103 Ga0068302_10116145 3300005071 Unclassified 2389
104 Ga0072941_1257313 3300005201 Bacteria 1458
105 Ga0123356_10002201 3300010049 Bacteria 20980
106 Ga0123356_10004762 3300010049 Bacteria 13963
107 Ga0466707_241599 3300042601 Bacteria 7102
108 Ga0466711_271880 3300042615 Bacteria 44119
109 Ga0466726_462438 3300042619 Bacteria 1952
110 Ga0466703_158975 3300042636 Bacteria 6080
111 Ga0466703_359076 3300042636 Bacteria 3843
112 Ga0466704_360893 3300042643 Bacteria 8881
113 Ga0466704_539994 3300042643 Bacteria 2638
114 Ga0466727_101001 3300042655 Bacteria 12270

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_360893 Ga0466704_360893_758_1921 387
2 3300042590 Ga0466690_064225 Ga0466690_064225_2411_3598 395
3 3300042636 Ga0466703_008369 Ga0466703_008369_7380_8567 395
4 3300042636 Ga0466703_158975 Ga0466703_158975_1312_2526 404
5 3300042643 Ga0466704_539994 Ga0466704_539994_325_1539 404
6 3300005083 Ga0068305_10067023 Ga0068305_100670235 409
7 3300042602 Ga0466713_048475 Ga0466713_048475_55312_56586 409
8 3300042655 Ga0466727_044570 Ga0466727_044570_1805_3088 409
9 3300042618 Ga0466723_074619 Ga0466723_074619_15428_16660 410
10 3300042593 Ga0466691_139689 Ga0466691_139689_2243_3484 413
11 3300042596 Ga0466696_112512 Ga0466696_112512_450_1691 413
12 3300042605 Ga0466716_206999 Ga0466716_206999_2324_3565 413
13 3300042605 Ga0466716_444952 Ga0466716_444952_602_1843 413
14 3300042616 Ga0466715_131385 Ga0466715_131385_13115_14356 413
15 3300042618 Ga0466723_311194 Ga0466723_311194_3094_4335 413
16 3300042636 Ga0466703_359076 Ga0466703_359076_1751_2992 413
17 3300042648 Ga0466709_053672 Ga0466709_053672_2283_3524 413
18 3300042612 Ga0466705_268544 Ga0466705_268544_2420_3706 414
19 3300042636 Ga0466703_088847 Ga0466703_088847_261_1505 414
20 3300005201 Ga0072941_1257313 Ga0072941_12573132 415
21 3300042592 Ga0466693_291239 Ga0466693_291239_53_1321 415
22 3300042616 Ga0466715_634006 Ga0466715_634006_42_1289 415
23 3300002834 JGI24696J40584_12959428 JGI24696J40584_129594284 417
24 3300042659 Ga0466733_203606 Ga0466733_203606_21428_22681 417
25 3300042596 Ga0466696_300579 Ga0466696_300579_4055_5314 419
26 3300010049 Ga0123356_10002017 Ga0123356_1000201714 420
27 3300042605 Ga0466716_199526 Ga0466716_199526_1151_2413 420
28 3300042618 Ga0466723_042738 Ga0466723_042738_43223_44485 420
29 3300042652 Ga0466708_063661 Ga0466708_063661_23844_25106 420
30 3300042620 Ga0466728_190351 Ga0466728_190351_52_1320 422
31 3300010167 Ga0123353_10001375 Ga0123353_1000137529 423
32 3300042606 Ga0466719_071014 Ga0466719_071014_131_1402 423
33 3300042619 Ga0466726_462438 Ga0466726_462438_113_1384 423
34 3300042636 Ga0466703_045360 Ga0466703_045360_3739_5010 423
35 3300042654 Ga0466725_072069 Ga0466725_072069_1346_2617 423
36 iso_pr_bacteria 2820783511 2820784147 423
37 3300010049 Ga0123356_10002201 Ga0123356_100022016 424
38 3300042590 Ga0466690_283372 Ga0466690_283372_8598_9872 424
39 3300042612 Ga0466705_024738 Ga0466705_024738_986_2260 424
40 3300042619 Ga0466726_126983 Ga0466726_126983_568_1842 424
41 3300042655 Ga0466727_101001 Ga0466727_101001_6441_7715 424
42 3300002504 JGI24705J35276_12231493 JGI24705J35276_122314934 425
43 3300005071 Ga0068302_10068579 Ga0068302_100685793 425
44 3300042608 Ga0466721_137594 Ga0466721_137594_3362_4639 425
45 3300042655 Ga0466727_168552 Ga0466727_168552_251_1528 425
46 iso_pr_bacteria 2820781750 2820782291 425
47 3300002462 JGI24702J35022_10019421 JGI24702J35022_100194212 426
48 3300010049 Ga0123356_10004762 Ga0123356_1000476213 426
49 3300010167 Ga0123353_10084233 Ga0123353_100842334 426
50 3300010167 Ga0123353_10525625 Ga0123353_105256251 426
51 3300042618 Ga0466723_012980 Ga0466723_012980_2361_3641 426
52 3300042618 Ga0466723_346543 Ga0466723_346543_6228_7508 426
53 3300042620 Ga0466728_262920 Ga0466728_262920_1550_2830 426
54 3300010167 Ga0123353_10218915 Ga0123353_102189152 427
55 3300042591 Ga0466692_022629 Ga0466692_022629_217_1500 427
56 3300042601 Ga0466707_241599 Ga0466707_241599_1445_2728 427
57 3300042619 Ga0466726_124574 Ga0466726_124574_2024_3307 427
58 3300042622 Ga0466731_200613 Ga0466731_200613_560_1987 427
59 3300042624 Ga0466735_033038 Ga0466735_033038_222_1505 427
60 3300042643 Ga0466704_047730 Ga0466704_047730_995_2278 427
61 3300005071 Ga0068302_10116145 Ga0068302_101161451 428
62 3300010049 Ga0123356_10180296 Ga0123356_101802962 428
63 3300042604 Ga0466717_287034 Ga0466717_287034_1581_2867 428
64 3300042605 Ga0466716_353124 Ga0466716_353124_658_1944 428
65 3300042606 Ga0466719_311757 Ga0466719_311757_498_1784 428
66 3300042612 Ga0466705_070881 Ga0466705_070881_413_1699 428
67 3300042612 Ga0466705_314339 Ga0466705_314339_2296_3582 428
68 3300042615 Ga0466711_271880 Ga0466711_271880_27469_28755 428
69 3300042620 Ga0466728_033548 Ga0466728_033548_15609_16895 428
70 3300042643 Ga0466704_226341 Ga0466704_226341_20492_21778 428
71 3300042643 Ga0466704_447782 Ga0466704_447782_51724_53010 428
72 3300042648 Ga0466709_203956 Ga0466709_203956_8220_9506 428
73 3300042652 Ga0466708_032710 Ga0466708_032710_13888_15174 428
74 iso_pr_bacteria 2940195863 2940198890 428
75 3300042596 Ga0466696_165558 Ga0466696_165558_647_1936 429
76 3300042606 Ga0466719_287942 Ga0466719_287942_6686_7975 429
77 3300042612 Ga0466705_252899 Ga0466705_252899_14951_16240 429
78 3300042616 Ga0466715_020762 Ga0466715_020762_25162_26451 429
79 3300042643 Ga0466704_407939 Ga0466704_407939_21425_22714 429
80 3300042654 Ga0466725_364926 Ga0466725_364926_12949_14238 429
81 3300042613 Ga0466710_171695 Ga0466710_171695_1095_2387 430
82 3300042648 Ga0466709_005524 Ga0466709_005524_122062_123354 430
83 3300042659 Ga0466733_018444 Ga0466733_018444_1413_2705 430
84 3300042659 Ga0466733_206935 Ga0466733_206935_4280_5572 430
85 3300005083 Ga0068305_10035606 Ga0068305_100356063 431
86 3300010882 Ga0123354_10133336 Ga0123354_101333362 431
87 3300042591 Ga0466692_203219 Ga0466692_203219_8272_9567 431
88 3300042606 Ga0466719_459978 Ga0466719_459978_10149_11444 431
89 3300042609 Ga0466722_148571 Ga0466722_148571_1166_2461 431
90 3300042636 Ga0466703_115609 Ga0466703_115609_2996_4291 431
91 3300010167 Ga0123353_10012947 Ga0123353_100129472 432
92 3300042609 Ga0466722_112533 Ga0466722_112533_1549_2847 432
93 3300042636 Ga0466703_029336 Ga0466703_029336_403_1701 432
94 3300042659 Ga0466733_103178 Ga0466733_103178_7111_8409 432
95 3300002462 JGI24702J35022_10001450 JGI24702J35022_100014504 433
96 3300010167 Ga0123353_10024733 Ga0123353_100247333 433
97 3300042596 Ga0466696_138955 Ga0466696_138955_886_2190 434
98 3300042618 Ga0466723_053892 Ga0466723_053892_6336_7640 434
99 3300042598 Ga0466701_102053 Ga0466701_102053_1694_3001 435
100 3300042590 Ga0466690_164485 Ga0466690_164485_4999_6309 436
101 3300042606 Ga0466719_295296 Ga0466719_295296_6256_7566 436
102 3300042636 Ga0466703_355333 Ga0466703_355333_14108_15418 436
103 3300042643 Ga0466704_150481 Ga0466704_150481_8685_9995 436
104 3300042655 Ga0466727_344797 Ga0466727_344797_9522_10832 436
105 3300005071 Ga0068302_10077706 Ga0068302_100777062 437
106 3300005083 Ga0068305_10046159 Ga0068305_100461595 437
107 3300042636 Ga0466703_344027 Ga0466703_344027_8533_9849 438
108 3300042590 Ga0466690_240583 Ga0466690_240583_392_1714 440
109 3300042598 Ga0466701_009508 Ga0466701_009508_5110_6447 440
110 3300042615 Ga0466711_165120 Ga0466711_165120_26403_27725 440
111 3300042624 Ga0466735_024733 Ga0466735_024733_74_1399 441
112 3300042606 Ga0466719_114910 Ga0466719_114910_1343_2671 442
113 3300002504 JGI24705J35276_12228529 JGI24705J35276_122285292 446
114 3300010167 Ga0123353_10532251 Ga0123353_105322512 456
115 3300042602 Ga0466713_084245 Ga0466713_084245_3697_5094 465
116 3300042615 Ga0466711_041848 Ga0466711_041848_24580_26004 474
117 3300042616 Ga0466715_204293 Ga0466715_204293_36521_37957 478

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF16217 M64_N Peptidase M64 N-terminus 75 190 0.98
PF09471 Peptidase_M64 IgA Peptidase M64 222 424 0.96

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3p1v-assembly1.cif.gz_A Crystal structure of a metallo-endopeptidases (BACOVA_00663) from Bacteroides ovatus at 1.93 A resolution 0.962 75 474
4df9-assembly3.cif.gz_F Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution 0.96 76 478
4df9-assembly1.cif.gz_B Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution 0.954 76 478
3p1v-assembly1.cif.gz_B Crystal structure of a metallo-endopeptidases (BACOVA_00663) from Bacteroides ovatus at 1.93 A resolution 0.953 75 474
4df9-assembly3.cif.gz_E Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution 0.95 76 478
IDDescriptionScoreStartEndSuperfamily
4df9E01 Mainly Beta;Sandwich;Immunoglobulin-like;Peptidase M64, N-terminal domain 0.9364 76 212 2.60.40.3250
3p1vB02 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9163 215 475 3.40.390.10
af_Q4E584_33_279_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7893 218 472 3.40.390.10
af_A0A1D6NBN0_917_1731_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.6787 173 200 3.90.550.10
af_A0A0R4ITJ9_653_731_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6628 124 200 2.60.40.10
IDDescriptionScoreStartEndGO Terms
AF-A0A7X9FUZ0-F1-model_v4 Uncharacterized/unreviewed 0.9889 222 379
AF-A0A3N5PWC6-F1-model_v4 Uncharacterized/unreviewed 0.988 76 476
AF-A0A1F3MGS6-F1-model_v4 Uncharacterized/unreviewed 0.9875 67 381
AF-A0A7Y5CIW5-F1-model_v4 Uncharacterized/unreviewed 0.9873 118 476

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.