Protein Family IF07697

Metagenome Isolate
137 Members
33 Samples
136 Scaffolds
556.21 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_199076|Ga0466715_199076_5150_6985
Length
611 aa
Sequence
VKTQFFIGFIPIAGFNIPWRAAVKRALKSAGMHSEKPVSPPPAPFRKQPLKALFFFSLFLFSQTLLFPFNFEREGDPEVLAGLLVGEMSDEQALAQTFMLGWVGATPSPLIMDWIRDRNIGGIKIFGWNTGDTLKLAETVGSLQRAALAGAFQIPLLVATDQEGGWIRHVKGATSETPGNMAIGASGYPMDAYWSGFYIGRELAVLGINMNFAPAVDLYTNRDSVLIGPRAFGNDPVRTGILGAAFVKGQQAAGIIATAKHYPGHGDTDLDSHGVLPQIRAPFELLWDRELIPYRLLAREGIPAIMSGHLAFPNTQAGETPASLSSWFLRDILRDRISYQGVIITDDLMMNGATTYAGSLSRAAKQALLAGNDIIMLSKTPNLSDPVWTYLVSSMREEREFRDRVRDAARRVLAVKLEYLRGDKKVSWIPDLKKVEENLPDLEAKAFFLDLAARSVTAIKGDSEASGGGGVFPLSPEKAGKILLAGQFEDFFSVGKIAYPDAVSCWFSSSQGEGELIRYAQNVDTIIFCLSEARDLRSLXXXRSLGKRVIVFSILSPVYLDETAWVDGAIAVYSYAKESFIAGFSMILGRIPAGGRLPFPLNEPRWVSPQG

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 43.8%
Termitidae 34.4%
Unclassified 9.4%
Termopsidae 6.2%
Hodotermitidae 3.1%
Rhinotermitidae 3.1%

🌳 Taxonomy

Archaea 1
Bacteria 127
Eukaryota 0
Viruses 1
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
4 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
5 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
6 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
7 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
8 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
9 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 650716102 Treponema primitia ZAS-2 Isolate Unclassified
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_048571 3300042615 Bacteria 3603
2 Ga0466711_099974 3300042615 Bacteria 18492
3 Ga0466715_195427 3300042616 Bacteria 3145
4 Ga0466715_534073 3300042616 Bacteria 5493
5 Ga0466726_100679 3300042619 Bacteria 2498
6 Ga0466726_261125 3300042619 Bacteria 14026
7 Ga0466706_135950 3300042599 Bacteria 25271
8 Ga0466700_022121 3300042600 Unclassified 2398
9 Ga0466722_238461 3300042609 Bacteria 6008
10 Ga0466690_096563 3300042590 Bacteria 16112
11 Ga0466705_263844 3300042612 Bacteria 6365
12 Ga0466704_084255 3300042643 Bacteria 4246
13 Ga0466709_353343 3300042648 Bacteria 4806
14 Ga0466727_265252 3300042655 Bacteria 2086
15 Ga0466705_392190 3300042612 Bacteria 3730
16 Ga0466705_435350 3300042612 Bacteria 3411
17 Ga0466711_305512 3300042615 Bacteria 13938
18 Ga0466711_506876 3300042615 Bacteria 6634
19 Ga0466715_335419 3300042616 Bacteria 4022
20 Ga0466723_034802 3300042618 Bacteria 4711
21 Ga0466728_110388 3300042620 Bacteria 15030
22 Ga0466728_311772 3300042620 Bacteria 5159
23 Ga0466716_283160 3300042605 Bacteria 7797
24 Ga0466719_041107 3300042606 Bacteria 9469
25 Ga0466719_054319 3300042606 Bacteria 5603
26 Ga0466719_266929 3300042606 Bacteria 24531
27 Ga0466722_200037 3300042609 Bacteria 9330
28 Ga0466690_117105 3300042590 Bacteria 5022
29 Ga0466691_227804 3300042593 Archaea 3391
30 Ga0466705_168935 3300042612 Bacteria 6471
31 Ga0466702_177076 3300042635 Bacteria 26172
32 Ga0466703_066311 3300042636 Bacteria 23126
33 Ga0466704_086985 3300042643 Unclassified 3866
34 Ga0466709_141905 3300042648 Bacteria 8632
35 Ga0466708_217097 3300042652 Bacteria 13274
36 Ga0466705_419960 3300042612 Bacteria 5307
37 Ga0466723_374201 3300042618 Bacteria 3670
38 Ga0466726_148020 3300042619 Bacteria 6033
39 Ga0466726_396360 3300042619 Bacteria 7444
40 Ga0466716_145772 3300042605 Bacteria 4682
41 Ga0466719_052414 3300042606 Bacteria 13658
42 Ga0264413_123840 3300024493 Bacteria 7672
43 Ga0466690_286348 3300042590 Bacteria 8069
44 Ga0466691_006909 3300042593 Bacteria 3745
45 Ga0466696_027217 3300042596 Bacteria 13020
46 Ga0466705_067441 3300042612 Unclassified 8174
47 Ga0466709_013258 3300042648 Unclassified 5342
48 Ga0466709_083873 3300042648 Bacteria 13811
49 Ga0466709_118393 3300042648 Bacteria 3143
50 Ga0466709_378031 3300042648 Bacteria 3160
51 Ga0466708_038124 3300042652 Bacteria 2675
52 Ga0466708_114752 3300042652 Bacteria 3629
53 Ga0466711_324294 3300042615 Bacteria 20953
54 Ga0466715_342951 3300042616 Bacteria 5314
55 Ga0466718_043116 3300042617 Bacteria 2026
56 Ga0466723_221021 3300042618 Bacteria 7076
57 Ga0466723_313594 3300042618 Bacteria 97104
58 Ga0466726_262033 3300042619 Bacteria 2762
59 Ga0466726_264291 3300042619 Bacteria 13165
60 Ga0123353_10106646 3300010167 Bacteria 4514
61 Ga0466716_087969 3300042605 Bacteria 4182
62 Ga0466719_339917 3300042606 Bacteria 3348
63 Ga0466722_015475 3300042609 Bacteria 2033
64 Ga0466690_182710 3300042590 Bacteria 10208
65 Ga0466691_104204 3300042593 Bacteria 18796
66 Ga0466696_332646 3300042596 Bacteria 7293
67 JGI24702J35022_10025231 3300002462 Bacteria 3209
68 Ga0466705_282676 3300042612 Viruses 2448
69 Ga0466703_091206 3300042636 Bacteria 37744
70 Ga0466703_418956 3300042636 Bacteria 3987
71 Ga0466727_033733 3300042655 Bacteria 14786
72 Ga0466712_058984 3300042614 Bacteria 8466
73 Ga0466715_430360 3300042616 Bacteria 1902
74 Ga0466723_260044 3300042618 Unclassified 10323
75 Ga0466723_345353 3300042618 Bacteria 13151
76 Ga0466728_150306 3300042620 Bacteria 6544
77 Ga0466728_229743 3300042620 Bacteria 5628
78 Ga0466719_354697 3300042606 Bacteria 16235
79 Ga0466690_096329 3300042590 Unclassified 3263
80 Ga0466705_234599 3300042612 Bacteria 10631
81 Ga0466703_037356 3300042636 Bacteria 2549
82 Ga0466703_157033 3300042636 Bacteria 8624
83 Ga0466703_226166 3300042636 Bacteria 2935
84 Ga0466708_171357 3300042652 Bacteria 10707
85 Ga0466715_106832 3300042616 Bacteria 7404
86 Ga0466715_171770 3300042616 Bacteria 2963
87 Ga0466715_199076 3300042616 Bacteria 12537
88 Ga0466715_317032 3300042616 Bacteria 9183
89 Ga0466723_103493 3300042618 Bacteria 19448
90 Ga0466726_066850 3300042619 Bacteria 2747
91 Ga0123357_10270814 3300009784 Bacteria 1775
92 Ga0466707_202066 3300042601 Unclassified 3864
93 Ga0466719_078840 3300042606 Bacteria 12999
94 Ga0466696_054305 3300042596 Bacteria 3985
95 Ga0466696_266527 3300042596 Bacteria 8331
96 Ga0466708_016347 3300042652 Bacteria 5164
97 Ga0466711_008234 3300042615 Bacteria 2428
98 Ga0466711_053634 3300042615 Bacteria 2254
99 Ga0466715_133547 3300042616 Bacteria 8508
100 Ga0466715_415985 3300042616 Bacteria 9046
101 Ga0466723_035249 3300042618 Bacteria 15913
102 Ga0466723_102470 3300042618 Bacteria 10211
103 Ga0466723_233646 3300042618 Unclassified 4915
104 Ga0466728_022104 3300042620 Bacteria 5293
105 Ga0466728_422231 3300042620 Bacteria 52940
106 Ga0466728_434743 3300042620 Bacteria 3243
107 Ga0466713_117863 3300042602 Bacteria 5934
108 Ga0466716_029455 3300042605 Bacteria 9996
109 Ga0466690_349010 3300042590 Bacteria 4619
110 Ga0466691_031667 3300042593 Bacteria 7103
111 Ga0466691_062260 3300042593 Bacteria 13313
112 Ga0466696_241441 3300042596 Bacteria 21872
113 Ga0466699_379330 3300042597 Bacteria 2022
114 Ga0466704_022603 3300042643 Bacteria 6714
115 Ga0466704_415370 3300042643 Bacteria 4343
116 Ga0466709_019236 3300042648 Bacteria 18315
117 Ga0466708_226169 3300042652 Bacteria 4705
118 Ga0466715_260645 3300042616 Bacteria 28966
119 Ga0466723_065503 3300042618 Bacteria 10421
120 Ga0466723_373578 3300042618 Bacteria 5010
121 Ga0466728_024495 3300042620 Bacteria 3351
122 Ga0466728_209324 3300042620 Bacteria 14460
123 Ga0123353_10011949 3300010167 Bacteria 12282
124 Ga0466716_484300 3300042605 Bacteria 5912
125 Ga0466719_182620 3300042606 Bacteria 8936
126 Ga0466720_014248 3300042607 Bacteria 6565
127 Ga0466690_227740 3300042590 Bacteria 4682
128 Ga0466694_118208 3300042594 Bacteria 29009
129 Ga0466694_326439 3300042594 Bacteria 9267
130 Ga0466694_376328 3300042594 Bacteria 3843
131 AustNasuHG_c1019119 3300000089 Bacteria 2253
132 Ga0466703_192749 3300042636 Bacteria 5755
133 Ga0466704_361590 3300042643 Bacteria 3665
134 Ga0466709_158445 3300042648 Bacteria 9470
135 Ga0466708_440807 3300042652 Bacteria 7090
136 Ga0466727_089830 3300042655 Bacteria 3513

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_150306 Ga0466728_150306_2698_4215 505
2 3300042616 Ga0466715_133547 Ga0466715_133547_5800_7350 509
3 3300042590 Ga0466690_117105 Ga0466690_117105_2039_3580 513
4 3300042605 Ga0466716_087969 Ga0466716_087969_1119_2660 513
5 3300042655 Ga0466727_033733 Ga0466727_033733_1285_2826 513
6 3300010167 Ga0123353_10106646 Ga0123353_101066465 515
7 3300042612 Ga0466705_282676 Ga0466705_282676_880_2427 515
8 3300042606 Ga0466719_182620 Ga0466719_182620_7089_8639 516
9 3300042618 Ga0466723_374201 Ga0466723_374201_2102_3655 517
10 3300042606 Ga0466719_266929 Ga0466719_266929_3452_5017 521
11 3300042606 Ga0466719_354697 Ga0466719_354697_1553_3154 533
12 3300042643 Ga0466704_361590 Ga0466704_361590_1015_2619 534
13 3300000089 AustNasuHG_c1019119 AustNasuHG_10191192 535
14 3300042643 Ga0466704_086985 Ga0466704_086985_1406_3013 535
15 3300042594 Ga0466694_326439 Ga0466694_326439_5858_7471 537
16 3300042593 Ga0466691_227804 Ga0466691_227804_1670_3289 539
17 3300042635 Ga0466702_177076 Ga0466702_177076_6149_7807 540
18 3300042612 Ga0466705_263844 Ga0466705_263844_1026_2651 541
19 3300042615 Ga0466711_506876 Ga0466711_506876_4428_6053 541
20 3300042620 Ga0466728_024495 Ga0466728_024495_132_1841 541
21 3300042648 Ga0466709_141905 Ga0466709_141905_1016_2641 541
22 3300042655 Ga0466727_089830 Ga0466727_089830_1553_3178 541
23 3300042612 Ga0466705_234599 Ga0466705_234599_8928_10556 542
24 3300042616 Ga0466715_171770 Ga0466715_171770_1091_2719 542
25 3300042615 Ga0466711_305512 Ga0466711_305512_8966_10597 543
26 3300042652 Ga0466708_114752 Ga0466708_114752_1656_3287 543
27 3300042614 Ga0466712_058984 Ga0466712_058984_788_2422 544
28 3300042616 Ga0466715_430360 Ga0466715_430360_108_1742 544
29 3300042619 Ga0466726_100679 Ga0466726_100679_53_1687 544
30 3300042601 Ga0466707_202066 Ga0466707_202066_826_2535 545
31 3300042619 Ga0466726_148020 Ga0466726_148020_3075_4751 545
32 3300042655 Ga0466727_265252 Ga0466727_265252_125_1762 545
33 3300002462 JGI24702J35022_10025231 JGI24702J35022_100252312 546
34 3300042616 Ga0466715_106832 Ga0466715_106832_4788_6428 546
35 3300042636 Ga0466703_037356 Ga0466703_037356_663_2330 546
36 3300042590 Ga0466690_227740 Ga0466690_227740_1544_3187 547
37 3300042594 Ga0466694_376328 Ga0466694_376328_794_2437 547
38 3300042616 Ga0466715_260645 Ga0466715_260645_12158_13801 547
39 3300042616 Ga0466715_534073 Ga0466715_534073_2272_3915 547
40 3300042607 Ga0466720_014248 Ga0466720_014248_850_2496 548
41 3300042609 Ga0466722_015475 Ga0466722_015475_232_1914 548
42 3300042612 Ga0466705_168935 Ga0466705_168935_4562_6208 548
43 3300042615 Ga0466711_324294 Ga0466711_324294_1568_3232 548
44 3300042594 Ga0466694_118208 Ga0466694_118208_22169_23818 549
45 3300042606 Ga0466719_054319 Ga0466719_054319_2232_3881 549
46 3300042606 Ga0466719_339917 Ga0466719_339917_461_2110 549
47 3300042615 Ga0466711_008234 Ga0466711_008234_72_1721 549
48 3300042616 Ga0466715_342951 Ga0466715_342951_2113_3762 549
49 3300042648 Ga0466709_118393 Ga0466709_118393_627_2276 549
50 3300010167 Ga0123353_10011949 Ga0123353_100119492 550
51 3300024493 Ga0264413_123840 Ga0264413_1238405 550
52 3300042612 Ga0466705_067441 Ga0466705_067441_1371_3026 551
53 3300042620 Ga0466728_110388 Ga0466728_110388_10484_12139 551
54 3300042652 Ga0466708_217097 Ga0466708_217097_5638_7293 551
55 3300042609 Ga0466722_238461 Ga0466722_238461_3552_5234 552
56 3300042616 Ga0466715_335419 Ga0466715_335419_784_2442 552
57 3300042596 Ga0466696_241441 Ga0466696_241441_18554_20215 553
58 3300042602 Ga0466713_117863 Ga0466713_117863_1173_2834 553
59 3300042618 Ga0466723_313594 Ga0466723_313594_78814_80475 553
60 3300042636 Ga0466703_066311 Ga0466703_066311_1848_3512 554
61 3300009784 Ga0123357_10270814 Ga0123357_102708141 555
62 3300042590 Ga0466690_286348 Ga0466690_286348_5265_6947 555
63 3300042618 Ga0466723_035249 Ga0466723_035249_3037_4704 555
64 3300042648 Ga0466709_158445 Ga0466709_158445_6963_8630 555
65 3300042618 Ga0466723_034802 Ga0466723_034802_1774_3444 556
66 3300042618 Ga0466723_065503 Ga0466723_065503_6100_7770 556
67 3300042619 Ga0466726_261125 Ga0466726_261125_450_2120 556
68 3300042606 Ga0466719_078840 Ga0466719_078840_10324_11997 557
69 3300042616 Ga0466715_415985 Ga0466715_415985_5432_7105 557
70 3300042643 Ga0466704_022603 Ga0466704_022603_1015_2688 557
71 3300042643 Ga0466704_084255 Ga0466704_084255_1270_2943 557
72 3300042648 Ga0466709_019236 Ga0466709_019236_4971_6644 557
73 3300042652 Ga0466708_440807 Ga0466708_440807_3224_4897 557
74 3300042618 Ga0466723_260044 Ga0466723_260044_5390_7066 558
75 3300042620 Ga0466728_229743 Ga0466728_229743_1533_3260 558
76 3300042596 Ga0466696_332646 Ga0466696_332646_3767_5446 559
77 3300042616 Ga0466715_317032 Ga0466715_317032_4475_6154 559
78 3300042618 Ga0466723_102470 Ga0466723_102470_7406_9085 559
79 3300042618 Ga0466723_233646 Ga0466723_233646_2732_4411 559
80 3300042618 Ga0466723_373578 Ga0466723_373578_1252_2931 559
81 3300042619 Ga0466726_066850 Ga0466726_066850_906_2585 559
82 3300042593 Ga0466691_006909 Ga0466691_006909_954_2636 560
83 3300042615 Ga0466711_048571 Ga0466711_048571_161_1843 560
84 3300042616 Ga0466715_195427 Ga0466715_195427_871_2553 560
85 3300042618 Ga0466723_221021 Ga0466723_221021_395_2077 560
86 3300042618 Ga0466723_345353 Ga0466723_345353_8541_10223 560
87 3300042593 Ga0466691_104204 Ga0466691_104204_15139_16824 561
88 3300042609 Ga0466722_200037 Ga0466722_200037_2954_4639 561
89 3300042606 Ga0466719_041107 Ga0466719_041107_4845_6533 562
90 3300042620 Ga0466728_209324 Ga0466728_209324_4184_5872 562
91 3300042652 Ga0466708_226169 Ga0466708_226169_830_2518 562
92 3300042590 Ga0466690_182710 Ga0466690_182710_7700_9391 563
93 3300042620 Ga0466728_311772 Ga0466728_311772_1708_3399 563
94 iso_pr_bacteria 650716102 650881013 563
95 3300042600 Ga0466700_022121 Ga0466700_022121_42_1736 564
96 3300042636 Ga0466703_226166 Ga0466703_226166_491_2185 564
97 3300042648 Ga0466709_013258 Ga0466709_013258_2028_3722 564
98 3300042597 Ga0466699_379330 Ga0466699_379330_207_1904 565
99 3300042615 Ga0466711_099974 Ga0466711_099974_5653_7350 565
100 3300042618 Ga0466723_103493 Ga0466723_103493_4406_6103 565
101 3300042619 Ga0466726_396360 Ga0466726_396360_3869_5566 565
102 3300042620 Ga0466728_434743 Ga0466728_434743_194_1891 565
103 3300042648 Ga0466709_378031 Ga0466709_378031_1179_2915 565
104 3300042596 Ga0466696_054305 Ga0466696_054305_1545_3248 567
105 3300042596 Ga0466696_266527 Ga0466696_266527_4849_6597 567
106 3300042605 Ga0466716_029455 Ga0466716_029455_5623_7326 567
107 3300042636 Ga0466703_418956 Ga0466703_418956_1107_2810 567
108 3300042648 Ga0466709_083873 Ga0466709_083873_1416_3119 567
109 3300042605 Ga0466716_283160 Ga0466716_283160_5231_6940 569
110 3300042619 Ga0466726_262033 Ga0466726_262033_452_2161 569
111 3300042599 Ga0466706_135950 Ga0466706_135950_14273_15985 570
112 3300042617 Ga0466718_043116 Ga0466718_043116_119_1831 570
113 3300042620 Ga0466728_422231 Ga0466728_422231_15593_17305 570
114 3300042636 Ga0466703_091206 Ga0466703_091206_2095_3810 571
115 3300042615 Ga0466711_053634 Ga0466711_053634_256_1974 572
116 3300042612 Ga0466705_435350 Ga0466705_435350_163_1887 574
117 3300042648 Ga0466709_353343 Ga0466709_353343_2837_4561 574
118 3300042590 Ga0466690_349010 Ga0466690_349010_1181_2908 575
119 3300042606 Ga0466719_052414 Ga0466719_052414_6304_8046 575
120 3300042590 Ga0466690_096563 Ga0466690_096563_149_1882 577
121 3300042605 Ga0466716_145772 Ga0466716_145772_102_1835 577
122 3300042596 Ga0466696_027217 Ga0466696_027217_2061_3797 578
123 3300042590 Ga0466690_096329 Ga0466690_096329_613_2352 579
124 3300042593 Ga0466691_062260 Ga0466691_062260_3122_4861 579
125 3300042636 Ga0466703_157033 Ga0466703_157033_4198_5946 582
126 3300042593 Ga0466691_031667 Ga0466691_031667_163_1914 583
127 3300042652 Ga0466708_016347 Ga0466708_016347_1466_3220 584
128 3300042612 Ga0466705_419960 Ga0466705_419960_1250_3007 585
129 3300042652 Ga0466708_038124 Ga0466708_038124_801_2561 586
130 3300042605 Ga0466716_484300 Ga0466716_484300_2886_4652 588
131 3300042612 Ga0466705_392190 Ga0466705_392190_130_1896 588
132 3300042619 Ga0466726_264291 Ga0466726_264291_1185_2951 588
133 3300042620 Ga0466728_022104 Ga0466728_022104_3393_5162 589
134 3300042636 Ga0466703_192749 Ga0466703_192749_2760_4562 600
135 3300042643 Ga0466704_415370 Ga0466704_415370_1590_3404 604
136 3300042652 Ga0466708_171357 Ga0466708_171357_6693_8513 606
137 3300042616 Ga0466715_199076 Ga0466715_199076_5150_6985 611

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 106 414 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.