Protein Family IF07692

Metagenome Isolate
125 Members
44 Samples
119 Scaffolds
350.37 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_189955|Ga0466715_189955_13736_14872
Length
378 aa
Sequence
MEDFVTDIENIAEDAGFIEDQEDAFYEHFRFVADKGQNLLRVDKFLVDRIEHASRNRIQLAAGAGFILANGRPVKSNYKVKPNDLITVVMDRPRRELDIIPEDIPLPVVYEDDDVIVIDKPPGLVVHPGHGNYTGTLLNALAWYMKDKPGFDTDDPRLGLVHRIDKDTSGLLVVAKNPESKTNLGAQFFRKTTQRKYLALVWGNVKDNEGRIEGNIGRNPKDKLQMTVFTDGENGRHAVTHYRVLERFGYVTMIECRLETGRTHQIRVHLKHIGHTLFNDERYGGNEILKGNHTTKYKQFIRNCFEICPRQALHAQTLGFVHPKTGKEMFFESPLPEDIKGLIEKFKEYEEKYRNHSRRLFIRNCCLDEKRPGNTIFY

📊 Sample Types

Isolate 4.8%
Metagenome 95.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 31.8%
Termitidae 29.5%
Unclassified 15.9%
Rhinotermitidae 9.1%
Passalidae 4.5%
Termopsidae 4.5%
Blattidae 2.3%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
2 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
3 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
4 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
9 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
10 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
11 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
12 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 IMNBL1DRAFT_c0000159 3300000062 Bacteria 59691
2 Ga0123357_10002060 3300009784 Bacteria 22051
3 Ga0466711_044131 3300042615 Bacteria 4750
4 Ga0466729_167400 3300042621 Bacteria 7440
5 Ga0466692_073863 3300042591 Bacteria 38781
6 Ga0466707_087470 3300042601 Bacteria 2368
7 Ga0466713_079678 3300042602 Bacteria 62372
8 Ga0466719_075501 3300042606 Bacteria 2268
9 Ga0123353_10518381 3300010167 Bacteria 1730
10 Ga0123354_10002668 3300010882 Bacteria 23860
11 Ga0466735_197533 3300042624 Bacteria 1528
12 Ga0466704_161006 3300042643 Bacteria 10935
13 Ga0466704_394722 3300042643 Bacteria 6803
14 Ga0466705_158665 3300042612 Bacteria 18276
15 JGI24699J35502_11133414 3300002509 Bacteria 10407
16 Ga0466711_253369 3300042615 Bacteria 6280
17 Ga0466715_241115 3300042616 Bacteria 19169
18 Ga0466715_469832 3300042616 Bacteria 3458
19 Ga0466723_276128 3300042618 Bacteria 3505
20 Ga0456237_0000403 3300041968 Bacteria 6524
21 Ga0466690_013202 3300042590 Bacteria 28519
22 Ga0466706_249871 3300042599 Bacteria 3283
23 Ga0466707_111993 3300042601 Bacteria 11357
24 Ga0466707_199068 3300042601 Bacteria 14926
25 Ga0466707_329671 3300042601 Bacteria 4250
26 Ga0123357_10296644 3300009784 Bacteria 1641
27 Ga0123353_10267574 3300010167 Bacteria 2636
28 Ga0466735_047137 3300042624 Bacteria 4945
29 Ga0466735_115888 3300042624 Bacteria 4081
30 Ga0466703_344396 3300042636 Bacteria 4476
31 Ga0466704_175541 3300042643 Bacteria 41528
32 Ga0466704_318489 3300042643 Bacteria 3320
33 Ga0466705_056487 3300042612 Bacteria 11616
34 Ga0466705_192801 3300042612 Bacteria 4036
35 Ga0466723_152652 3300042618 Bacteria 5929
36 Ga0466728_135541 3300042620 Bacteria 2869
37 Ga0466690_077926 3300042590 Bacteria 4747
38 Ga0466700_390206 3300042600 Bacteria 53046
39 Ga0466707_331466 3300042601 Bacteria 9692
40 Ga0466719_236977 3300042606 Bacteria 1799
41 Ga0466722_201363 3300042609 Bacteria 3210
42 Ga0466698_381079 3300042610 Bacteria 4326
43 Ga0466709_378434 3300042648 Bacteria 7543
44 Ga0466697_135425 3300042611 Bacteria 2426
45 IMNBL1DRAFT_c0000956 3300000062 Bacteria 22304
46 Ga0466715_111272 3300042616 Bacteria 10912
47 Ga0466690_105531 3300042590 Bacteria 14462
48 Ga0466691_049926 3300042593 Bacteria 11408
49 Ga0466691_187837 3300042593 Bacteria 10413
50 Ga0466696_092643 3300042596 Bacteria 9529
51 Ga0466700_064176 3300042600 Bacteria 23341
52 Ga0466719_116552 3300042606 Bacteria 3692
53 Ga0466719_493339 3300042606 Bacteria 8624
54 Ga0466722_000740 3300042609 Bacteria 3556
55 Ga0123354_10000098 3300010882 Bacteria 64634
56 Ga0123354_10001798 3300010882 Bacteria 27042
57 Ga0123354_10186644 3300010882 Unclassified 2342
58 Ga0466734_077524 3300042623 Bacteria 2490
59 Ga0466703_092708 3300042636 Bacteria 10215
60 Ga0466703_176430 3300042636 Bacteria 35435
61 Ga0466708_053168 3300042652 Bacteria 12127
62 JGI24702J35022_10001033 3300002462 Bacteria 17405
63 JGI24702J35022_10009807 3300002462 Bacteria 5369
64 JGI24699J35502_11131956 3300002509 Bacteria 6213
65 JGI24699J35502_11133942 3300002509 Bacteria 20441
66 Ga0466715_189955 3300042616 Bacteria 18415
67 Ga0466690_381813 3300042590 Bacteria 66142
68 Ga0466692_099774 3300042591 Bacteria 51055
69 Ga0466692_175276 3300042591 Bacteria 1855
70 Ga0466700_432608 3300042600 Bacteria 3389
71 Ga0466707_033660 3300042601 Bacteria 25263
72 Ga0466707_113516 3300042601 Bacteria 14148
73 Ga0466716_357447 3300042605 Bacteria 3098
74 Ga0123357_10004643 3300009784 Bacteria 16204
75 Ga0123357_10022878 3300009784 Bacteria 8387
76 Ga0123357_10071588 3300009784 Bacteria 4597
77 Ga0123354_10062435 3300010882 Unclassified 5485
78 Ga0123354_10126893 3300010882 Bacteria 3252
79 Ga0466735_170604 3300042624 Bacteria 35167
80 Ga0466703_037449 3300042636 Bacteria 1360
81 Ga0466704_429455 3300042643 Unclassified 4032
82 Ga0466727_122982 3300042655 Bacteria 40069
83 JGI24705J35276_12213745 3300002504 Bacteria 1935
84 JGI24705J35276_12234530 3300002504 Bacteria 5612
85 Ga0466690_205343 3300042590 Bacteria 7755
86 Ga0466692_177107 3300042591 Bacteria 23256
87 Ga0466701_036693 3300042598 Bacteria 31751
88 Ga0466719_308788 3300042606 Bacteria 5630
89 Ga0123357_10015473 3300009784 Bacteria 10002
90 Ga0123357_10096578 3300009784 Bacteria 3826
91 Ga0123354_10151307 3300010882 Bacteria 2810
92 Ga0466729_264174 3300042621 Bacteria 4914
93 Ga0466735_018201 3300042624 Bacteria 2936
94 Ga0466705_045085 3300042612 Bacteria 9322
95 2227472152 2225789004 Unclassified 4818
96 IMNBL1DRAFT_c0007061 3300000062 Bacteria 5983
97 Ga0123357_10002736 3300009784 Bacteria 19873
98 Ga0466715_400161 3300042616 Bacteria 8851
99 Ga0466701_091389 3300042598 Bacteria 105479
100 Ga0466700_065731 3300042600 Bacteria 5367
101 Ga0466714_017011 3300042603 Bacteria 20937
102 Ga0466716_274033 3300042605 Bacteria 7183
103 Ga0123354_10311030 3300010882 Bacteria 1471
104 Ga0466735_017066 3300042624 Bacteria 6211
105 Ga0466735_221045 3300042624 Unclassified 2426
106 Ga0466704_444884 3300042643 Bacteria 9544
107 Ga0123357_10000101 3300009784 Bacteria 70940
108 Ga0466715_263547 3300042616 Bacteria 4883
109 Ga0466690_247349 3300042590 Bacteria 25016
110 Ga0466707_098117 3300042601 Unclassified 4210
111 Ga0466713_017528 3300042602 Bacteria 17038
112 Ga0466722_046727 3300042609 Bacteria 1284
113 Ga0123357_10006162 3300009784 Bacteria 14543
114 Ga0123357_10222982 3300009784 Bacteria 2086
115 Ga0123356_10181212 3300010049 Bacteria 2128
116 Ga0123354_10001055 3300010882 Bacteria 31731
117 Ga0123354_10003944 3300010882 Bacteria 20768
118 Ga0466735_050574 3300042624 Bacteria 1702
119 Ga0466704_307788 3300042643 Bacteria 15366

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042623 Ga0466734_077524 Ga0466734_077524_1518_2435 305
2 3300042609 Ga0466722_046727 Ga0466722_046727_14_976 320
3 3300010882 Ga0123354_10002668 Ga0123354_1000266817 321
4 3300042590 Ga0466690_013202 Ga0466690_013202_26049_27059 321
5 3300010882 Ga0123354_10186644 Ga0123354_101866442 332
6 3300042601 Ga0466707_033660 Ga0466707_033660_21066_22106 334
7 3300042606 Ga0466719_075501 Ga0466719_075501_1042_2046 334
8 3300010882 Ga0123354_10001798 Ga0123354_1000179812 336
9 3300042598 Ga0466701_036693 Ga0466701_036693_21963_23021 337
10 3300042590 Ga0466690_105531 Ga0466690_105531_10842_11864 340
11 3300041968 Ga0456237_0000403 Ga0456237_0000403_4393_5421 342
12 3300042591 Ga0466692_175276 Ga0466692_175276_327_1355 342
13 3300042600 Ga0466700_390206 Ga0466700_390206_25890_26957 342
14 3300042611 Ga0466697_135425 Ga0466697_135425_102_1157 342
15 iso_pr_bacteria 643348524 643422755 342
16 3300042593 Ga0466691_187837 Ga0466691_187837_7770_8801 343
17 3300042616 Ga0466715_241115 Ga0466715_241115_15937_17007 343
18 3300042624 Ga0466735_170604 Ga0466735_170604_2565_3596 343
19 iso_pr_bacteria 2967483437 2967487094 343
20 3300042590 Ga0466690_247349 Ga0466690_247349_22712_23746 344
21 3300042605 Ga0466716_274033 Ga0466716_274033_1390_2424 344
22 3300042615 Ga0466711_253369 Ga0466711_253369_2818_3852 344
23 3300042618 Ga0466723_276128 Ga0466723_276128_1364_2398 344
24 3300002504 JGI24705J35276_12234530 JGI24705J35276_122345303 345
25 3300009784 Ga0123357_10071588 Ga0123357_100715884 345
26 3300042643 Ga0466704_394722 Ga0466704_394722_5297_6334 345
27 3300010049 Ga0123356_10181212 Ga0123356_101812123 346
28 3300042601 Ga0466707_087470 Ga0466707_087470_1049_2089 346
29 3300042590 Ga0466690_077926 Ga0466690_077926_1220_2263 347
30 3300042593 Ga0466691_049926 Ga0466691_049926_1685_2728 347
31 3300042602 Ga0466713_017528 Ga0466713_017528_4679_5722 347
32 3300042615 Ga0466711_044131 Ga0466711_044131_951_1994 347
33 3300042616 Ga0466715_469832 Ga0466715_469832_1187_2287 347
34 3300002462 JGI24702J35022_10001033 JGI24702J35022_1000103313 348
35 3300009784 Ga0123357_10002060 Ga0123357_1000206013 348
36 3300042618 Ga0466723_152652 Ga0466723_152652_3256_4302 348
37 3300009784 Ga0123357_10002736 Ga0123357_1000273614 349
38 3300042591 Ga0466692_073863 Ga0466692_073863_25361_26410 349
39 3300042603 Ga0466714_017011 Ga0466714_017011_11270_12319 349
40 3300042606 Ga0466719_308788 Ga0466719_308788_2923_3972 349
41 3300010882 Ga0123354_10126893 Ga0123354_101268933 350
42 3300042590 Ga0466690_381813 Ga0466690_381813_40141_41193 350
43 3300042620 Ga0466728_135541 Ga0466728_135541_654_1706 350
44 3300042600 Ga0466700_064176 Ga0466700_064176_15104_16159 351
45 3300042600 Ga0466700_065731 Ga0466700_065731_1991_3046 351
46 3300042600 Ga0466700_432608 Ga0466700_432608_1480_2535 351
47 3300042601 Ga0466707_199068 Ga0466707_199068_861_1916 351
48 3300042601 Ga0466707_329671 Ga0466707_329671_1592_2647 351
49 3300042602 Ga0466713_079678 Ga0466713_079678_22222_23277 351
50 3300042606 Ga0466719_116552 Ga0466719_116552_200_1255 351
51 3300042609 Ga0466722_201363 Ga0466722_201363_1173_2228 351
52 3300042624 Ga0466735_047137 Ga0466735_047137_3245_4300 351
53 3300042624 Ga0466735_050574 Ga0466735_050574_121_1176 351
54 3300042624 Ga0466735_115888 Ga0466735_115888_1941_2996 351
55 3300042655 Ga0466727_122982 Ga0466727_122982_7128_8183 351
56 iso_pr_bacteria 2820759988 2820761317 351
57 3300002504 JGI24705J35276_12213745 JGI24705J35276_122137452 352
58 3300002509 JGI24699J35502_11131956 JGI24699J35502_111319565 352
59 3300002509 JGI24699J35502_11133942 JGI24699J35502_1113394211 352
60 3300009784 Ga0123357_10004643 Ga0123357_1000464321 352
61 3300009784 Ga0123357_10006162 Ga0123357_100061623 352
62 3300009784 Ga0123357_10015473 Ga0123357_100154736 352
63 3300009784 Ga0123357_10022878 Ga0123357_100228786 352
64 3300010882 Ga0123354_10000098 Ga0123354_1000009841 352
65 3300010882 Ga0123354_10001055 Ga0123354_100010555 352
66 3300010882 Ga0123354_10062435 Ga0123354_100624352 352
67 3300010882 Ga0123354_10151307 Ga0123354_101513073 352
68 3300042601 Ga0466707_111993 Ga0466707_111993_3868_4926 352
69 3300042612 Ga0466705_056487 Ga0466705_056487_9575_10633 352
70 3300042643 Ga0466704_161006 Ga0466704_161006_1261_2319 352
71 3300042643 Ga0466704_429455 Ga0466704_429455_282_1340 352
72 3300009784 Ga0123357_10096578 Ga0123357_100965783 353
73 3300010882 Ga0123354_10003944 Ga0123354_100039448 353
74 3300042612 Ga0466705_158665 Ga0466705_158665_913_1974 353
75 3300042616 Ga0466715_263547 Ga0466715_263547_1669_2730 353
76 3300042624 Ga0466735_018201 Ga0466735_018201_312_1373 353
77 3300042643 Ga0466704_318489 Ga0466704_318489_1162_2223 353
78 2225789004 2227472152 2227919633 354
79 3300000062 IMNBL1DRAFT_c0000159 IMNBL1DRAFT_00001595 354
80 3300042601 Ga0466707_113516 Ga0466707_113516_3947_5011 354
81 3300042610 Ga0466698_381079 Ga0466698_381079_2778_3842 354
82 3300042612 Ga0466705_045085 Ga0466705_045085_5545_6630 354
83 3300042624 Ga0466735_017066 Ga0466735_017066_4084_5148 354
84 3300042624 Ga0466735_221045 Ga0466735_221045_837_1901 354
85 3300042643 Ga0466704_175541 Ga0466704_175541_27201_28265 354
86 3300042643 Ga0466704_444884 Ga0466704_444884_7078_8142 354
87 3300000062 IMNBL1DRAFT_c0000956 IMNBL1DRAFT_000095617 355
88 3300042590 Ga0466690_205343 Ga0466690_205343_1625_2692 355
89 3300042598 Ga0466701_091389 Ga0466701_091389_12487_13554 355
90 3300042599 Ga0466706_249871 Ga0466706_249871_1391_2458 355
91 3300042606 Ga0466719_236977 Ga0466719_236977_369_1436 355
92 3300042612 Ga0466705_192801 Ga0466705_192801_352_1419 355
93 3300042616 Ga0466715_111272 Ga0466715_111272_8751_9818 355
94 3300042616 Ga0466715_400161 Ga0466715_400161_4570_5637 355
95 3300042636 Ga0466703_037449 Ga0466703_037449_136_1203 355
96 3300042636 Ga0466703_176430 Ga0466703_176430_17972_19039 355
97 iso_pr_bacteria 2940216256 2940218188 355
98 3300000062 IMNBL1DRAFT_c0007061 IMNBL1DRAFT_00070614 356
99 3300010167 Ga0123353_10267574 Ga0123353_102675742 356
100 3300010167 Ga0123353_10518381 Ga0123353_105183811 356
101 3300042591 Ga0466692_177107 Ga0466692_177107_16413_17483 356
102 3300042601 Ga0466707_098117 Ga0466707_098117_1216_2286 356
103 3300042606 Ga0466719_493339 Ga0466719_493339_1174_2244 356
104 3300042609 Ga0466722_000740 Ga0466722_000740_1796_2866 356
105 3300042624 Ga0466735_197533 Ga0466735_197533_90_1160 356
106 3300042636 Ga0466703_092708 Ga0466703_092708_1730_2800 356
107 3300002462 JGI24702J35022_10009807 JGI24702J35022_100098072 357
108 3300010882 Ga0123354_10311030 Ga0123354_103110302 357
109 3300042591 Ga0466692_099774 Ga0466692_099774_16703_17776 357
110 3300042596 Ga0466696_092643 Ga0466696_092643_4234_5307 357
111 3300042605 Ga0466716_357447 Ga0466716_357447_679_1752 357
112 3300042621 Ga0466729_167400 Ga0466729_167400_4433_5506 357
113 3300009784 Ga0123357_10222982 Ga0123357_102229822 358
114 3300042621 Ga0466729_264174 Ga0466729_264174_306_1382 358
115 iso_pr_bacteria 2820762746 2820762966 358
116 3300002509 JGI24699J35502_11133414 JGI24699J35502_111334148 359
117 3300009784 Ga0123357_10296644 Ga0123357_102966441 359
118 3300042652 Ga0466708_053168 Ga0466708_053168_4685_5764 359
119 3300042636 Ga0466703_344396 Ga0466703_344396_1551_2633 360
120 3300042643 Ga0466704_307788 Ga0466704_307788_4978_6060 360
121 iso_pr_bacteria 2820778767 2820779038 360
122 3300009784 Ga0123357_10000101 Ga0123357_1000010130 361
123 3300042601 Ga0466707_331466 Ga0466707_331466_6808_7914 368
124 3300042648 Ga0466709_378434 Ga0466709_378434_6371_7483 370
125 3300042616 Ga0466715_189955 Ga0466715_189955_13736_14872 378

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00849 PseudoU_synth_2 RNA pseudouridylate synthase 114 272 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.