Protein Family IF07691

Metagenome Isolate
159 Members
67 Samples
134 Scaffolds
141.35 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_186828|Ga0466715_186828_4699_5172
Length
157 aa
Sequence
MLPAHLSAFIYLSLHPMGRIMAIDYGRKRSGLAVTDTLQLIAGGLETVPSGKLVEYISDYVQREPVDRLIVGLPKQMNNEVSENMKYVEAFVTHLKRSIPGIPVQYYDERFTSVLAQRAMREGGLKKKKRQNKALTDKISAVIILQSYLESKKTTTI

📊 Sample Types

Isolate 15.7%
Metagenome 84.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 29.9%
Termitidae 22.4%
Kalotermitidae 19.4%
Unclassified 7.5%
Rhinotermitidae 4.5%
Passalidae 4.5%
Termopsidae 4.5%
Hydrophilidae 3.0%
Hodotermitidae 1.5%
Drosophilidae 1.5%
Tenebrionidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2923982719 Parabacteroides sp. 52 Isolate Blattidae
9 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
10 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
11 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
16 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
17 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
21 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
22 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
23 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
24 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
25 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
33 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
34 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
35 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
38 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
39 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
40 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
47 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
48 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
51 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
52 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
53 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
54 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
55 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
56 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
57 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
58 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
59 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
60 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
61 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
62 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
63 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
64 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
65 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
66 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
67 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466730_048250 3300042625 Unclassified 2464
2 Ga0466703_387204 3300042636 Bacteria 10307
3 Ga0466704_352259 3300042643 Bacteria 8413
4 Ga0466709_412691 3300042648 Bacteria 4861
5 Ga0466727_044747 3300042655 Bacteria 3248
6 Ga0466711_004876 3300042615 Bacteria 13509
7 Ga0466711_025328 3300042615 Bacteria 13277
8 Ga0466715_186828 3300042616 Bacteria 12554
9 Ga0466715_386437 3300042616 Bacteria 19983
10 Ga0466696_300407 3300042596 Bacteria 4440
11 Ga0466706_280456 3300042599 Bacteria 15607
12 Ga0466717_244571 3300042604 Bacteria 1261
13 Ga0466716_349737 3300042605 Bacteria 18598
14 Ga0466719_052340 3300042606 Bacteria 15916
15 Ga0123357_10683620 3300009784 Bacteria 743
16 Ga0123356_10649873 3300010049 Bacteria 1222
17 Ga0123353_11260526 3300010167 Bacteria 964
18 JGI24705J35276_12219717 3300002504 Bacteria 2221
19 Ga0068305_10018409 3300005083 Unclassified 11089
20 Ga0466705_262482 3300042612 Bacteria 1380
21 Ga0466705_326106 3300042612 Bacteria 40770
22 Ga0466733_174129 3300042659 Bacteria 23754
23 Ga0466735_203942 3300042624 Bacteria 4108
24 Ga0466705_400119 3300042612 Bacteria 34089
25 Ga0466711_408129 3300042615 Bacteria 10541
26 Ga0466690_092197 3300042590 Bacteria 28749
27 Ga0466690_333134 3300042590 Bacteria 14905
28 Ga0466691_043152 3300042593 Bacteria 12747
29 Ga0466719_173135 3300042606 Bacteria 1460
30 Ga0123357_10006062 3300009784 Bacteria 14634
31 Ga0123357_10276420 3300009784 Bacteria 1744
32 Ga0123353_10281216 3300010167 Bacteria 2555
33 Ga0123353_12849769 3300010167 Bacteria 565
34 Ga0466705_198378 3300042612 Bacteria 14888
35 Ga0466705_274599 3300042612 Bacteria 1117
36 Ga0466733_070581 3300042659 Bacteria 40188
37 Ga0466711_222547 3300042615 Bacteria 19633
38 Ga0466723_086277 3300042618 Bacteria 16197
39 Ga0466723_193043 3300042618 Bacteria 34490
40 Ga0466728_415375 3300042620 Bacteria 16610
41 Ga0466656_170778 3300042550 Bacteria 1524
42 Ga0466696_117205 3300042596 Bacteria 2332
43 Ga0466713_026688 3300042602 Bacteria 1635
44 2227149976 2225789004 Unclassified 1592
45 IMNBL1DRAFT_c0001868 3300000062 Bacteria 15333
46 JGI24705J35276_12238425 3300002504 Bacteria 21658
47 JGI24696J40584_12881119 3300002834 Bacteria 1085
48 Ga0466703_071422 3300042636 Bacteria 20891
49 Ga0466703_109020 3300042636 Bacteria 4584
50 Ga0466704_245507 3300042643 Bacteria 3562
51 Ga0466727_075374 3300042655 Bacteria 9191
52 Ga0466715_563767 3300042616 Bacteria 24196
53 Ga0466729_112099 3300042621 Bacteria 18792
54 Ga0466690_059176 3300042590 Bacteria 2405
55 Ga0466706_047388 3300042599 Bacteria 18343
56 Ga0466713_006966 3300042602 Bacteria 26233
57 Ga0466716_507390 3300042605 Bacteria 50325
58 Ga0123353_11355857 3300010167 Bacteria 918
59 IMNBL1DRAFT_c0002014 3300000062 Bacteria 14560
60 JGI24702J35022_10033559 3300002462 Bacteria 2746
61 Ga0466735_113870 3300042624 Bacteria 5300
62 Ga0466735_191006 3300042624 Bacteria 1805
63 Ga0466704_146857 3300042643 Bacteria 17615
64 Ga0466715_047082 3300042616 Bacteria 54165
65 Ga0466690_044253 3300042590 Bacteria 4682
66 Ga0466696_137772 3300042596 Bacteria 7423
67 Ga0466706_163843 3300042599 Bacteria 10543
68 Ga0466713_123312 3300042602 Bacteria 4668
69 Ga0123356_10019680 3300010049 Bacteria 6398
70 Ga0123356_10490245 3300010049 Bacteria 1383
71 Ga0123356_10684155 3300010049 Bacteria 1194
72 Ga0123353_13147010 3300010167 Bacteria 530
73 Ga0123354_10056511 3300010882 Bacteria 5859
74 2227222480 2225789004 Bacteria 7461
75 Ga0104040_1144528 3300007149 Bacteria 1741
76 Ga0466705_057888 3300042612 Bacteria 11703
77 Ga0562377_0004 3300056842 Bacteria 3525959
78 Ga0466704_295144 3300042643 Bacteria 2935
79 Ga0466727_150494 3300042655 Unclassified 4396
80 Ga0466705_406286 3300042612 Bacteria 1021
81 Ga0466711_039763 3300042615 Bacteria 11750
82 Ga0466715_516781 3300042616 Bacteria 18003
83 Ga0466715_642375 3300042616 Bacteria 8836
84 Ga0466728_376933 3300042620 Bacteria 5387
85 Ga0466729_166751 3300042621 Bacteria 2788
86 Ga0466690_402470 3300042590 Bacteria 7671
87 Ga0466696_253210 3300042596 Bacteria 201850
88 Ga0466701_033217 3300042598 Bacteria 4314
89 Ga0466719_237679 3300042606 Bacteria 1268
90 Ga0466722_154973 3300042609 Bacteria 4247
91 Ga0123356_12208463 3300010049 Bacteria 688
92 Ga0466703_336099 3300042636 Bacteria 22653
93 Ga0466704_345086 3300042643 Bacteria 6891
94 Ga0466704_359414 3300042643 Bacteria 5731
95 Ga0466709_180771 3300042648 Bacteria 2291
96 Ga0466726_140263 3300042619 Bacteria 5015
97 Ga0466729_081173 3300042621 Bacteria 2885
98 Ga0466696_127913 3300042596 Bacteria 17134
99 Ga0466700_255019 3300042600 Bacteria 1618
100 Ga0466713_020992 3300042602 Bacteria 62959
101 Ga0466716_195372 3300042605 Bacteria 22749
102 Ga0466719_192586 3300042606 Bacteria 3451
103 Ga0466722_253218 3300042609 Bacteria 1333
104 Ga0123357_10289213 3300009784 Bacteria 1677
105 2227646845 2225789004 Bacteria 10925
106 Ga0068305_10060045 3300005083 Bacteria 12737
107 Ga0466733_120112 3300042659 Bacteria 197910
108 Ga0466735_168994 3300042624 Bacteria 1129
109 Ga0466703_160950 3300042636 Bacteria 8217
110 Ga0466703_214432 3300042636 Bacteria 3316
111 Ga0466704_084380 3300042643 Bacteria 14804
112 Ga0466704_119527 3300042643 Bacteria 22827
113 Ga0466709_419248 3300042648 Bacteria 2668
114 Ga0466715_397790 3300042616 Bacteria 5427
115 Ga0466726_284900 3300042619 Bacteria 1475
116 Ga0466690_029345 3300042590 Bacteria 8622
117 Ga0466690_292067 3300042590 Bacteria 2394
118 Ga0466691_082783 3300042593 Bacteria 28065
119 Ga0466694_251173 3300042594 Bacteria 1707
120 Ga0466706_126051 3300042599 Bacteria 1779
121 Ga0466706_192668 3300042599 Bacteria 87404
122 Ga0466707_054277 3300042601 Bacteria 2595
123 Ga0466707_358801 3300042601 Bacteria 2528
124 Ga0466716_061788 3300042605 Bacteria 14272
125 Ga0466697_056567 3300042611 Bacteria 485126
126 Ga0123357_10592070 3300009784 Bacteria 857
127 Ga0123353_10362377 3300010167 Bacteria 2178
128 Ga0123353_10420174 3300010167 Bacteria 1981
129 2227035914 2225789003 Bacteria 20618
130 2227477412 2225789004 Bacteria 22379
131 2227482969 2225789004 Bacteria 21843
132 JGI24702J35022_10125593 3300002462 Bacteria 1420
133 JGI24696J40584_12606662 3300002834 Bacteria 661
134 Ga0068305_10069228 3300005083 Bacteria 15642

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042625 Ga0466730_048250 Ga0466730_048250_39_419 126
2 3300042605 Ga0466716_507390 Ga0466716_507390_35235_35651 127
3 3300042550 Ga0466656_170778 Ga0466656_170778_143_559 128
4 3300005083 Ga0068305_10018409 Ga0068305_100184097 132
5 3300042648 Ga0466709_412691 Ga0466709_412691_2618_3043 132
6 3300042599 Ga0466706_280456 Ga0466706_280456_1464_1865 133
7 3300042602 Ga0466713_026688 Ga0466713_026688_51_452 133
8 3300042616 Ga0466715_386437 Ga0466715_386437_12472_12873 133
9 3300042596 Ga0466696_253210 Ga0466696_253210_131812_132216 134
10 3300042601 Ga0466707_054277 Ga0466707_054277_1646_2050 134
11 3300042599 Ga0466706_126051 Ga0466706_126051_826_1236 136
12 3300042606 Ga0466719_052340 Ga0466719_052340_1421_1831 136
13 3300042620 Ga0466728_376933 Ga0466728_376933_3014_3424 136
14 3300042636 Ga0466703_071422 Ga0466703_071422_752_1162 136
15 3300042601 Ga0466707_358801 Ga0466707_358801_91_504 137
16 3300042621 Ga0466729_081173 Ga0466729_081173_67_480 137
17 3300042624 Ga0466735_203942 Ga0466735_203942_2635_3048 137
18 iso_pr_bacteria 2940195863 2940198764 137
19 iso_pr_bacteria 2940199050 2940201514 137
20 iso_pr_bacteria 2940209341 2940210619 137
21 iso_pr_bacteria 2940346213 2940348669 137
22 3300042590 Ga0466690_092197 Ga0466690_092197_11424_11840 138
23 3300042598 Ga0466701_033217 Ga0466701_033217_244_660 138
24 3300042599 Ga0466706_047388 Ga0466706_047388_2248_2664 138
25 3300042606 Ga0466719_192586 Ga0466719_192586_1299_1715 138
26 3300042612 Ga0466705_262482 Ga0466705_262482_190_606 138
27 3300042612 Ga0466705_274599 Ga0466705_274599_189_605 138
28 3300042615 Ga0466711_408129 Ga0466711_408129_7771_8187 138
29 3300042616 Ga0466715_563767 Ga0466715_563767_10071_10487 138
30 3300042619 Ga0466726_140263 Ga0466726_140263_1581_1997 138
31 3300042620 Ga0466728_415375 Ga0466728_415375_12578_12994 138
32 3300042636 Ga0466703_336099 Ga0466703_336099_11524_11940 138
33 3300042636 Ga0466703_387204 Ga0466703_387204_4179_4595 138
34 3300042643 Ga0466704_245507 Ga0466704_245507_1237_1653 138
35 3300042643 Ga0466704_359414 Ga0466704_359414_300_716 138
36 3300042655 Ga0466727_044747 Ga0466727_044747_1509_1925 138
37 2225789003 2227035914 2227396289 139
38 2225789004 2227149976 2227555293 139
39 2225789004 2227482969 2227945497 139
40 2225789004 2227646845 2228240255 139
41 3300010882 Ga0123354_10056511 Ga0123354_100565112 139
42 3300042602 Ga0466713_123312 Ga0466713_123312_4018_4437 139
43 3300042609 Ga0466722_253218 Ga0466722_253218_87_506 139
44 3300042611 Ga0466697_056567 Ga0466697_056567_65743_66162 139
45 3300042612 Ga0466705_400119 Ga0466705_400119_11291_11710 139
46 3300042624 Ga0466735_191006 Ga0466735_191006_258_677 139
47 3300042636 Ga0466703_109020 Ga0466703_109020_2976_3395 139
48 3300042643 Ga0466704_345086 Ga0466704_345086_4562_4981 139
49 3300042648 Ga0466709_180771 Ga0466709_180771_1353_1772 139
50 3300042659 Ga0466733_070581 Ga0466733_070581_7191_7610 139
51 2225789004 2227477412 2227931559 140
52 3300000062 IMNBL1DRAFT_c0002014 IMNBL1DRAFT_00020146 140
53 3300042590 Ga0466690_029345 Ga0466690_029345_4159_4581 140
54 3300042590 Ga0466690_044253 Ga0466690_044253_1644_2066 140
55 3300042590 Ga0466690_402470 Ga0466690_402470_5510_5932 140
56 3300042593 Ga0466691_082783 Ga0466691_082783_24033_24455 140
57 3300042596 Ga0466696_127913 Ga0466696_127913_10697_11119 140
58 3300042596 Ga0466696_137772 Ga0466696_137772_4350_4772 140
59 3300042596 Ga0466696_300407 Ga0466696_300407_2135_2557 140
60 3300042600 Ga0466700_255019 Ga0466700_255019_877_1299 140
61 3300042602 Ga0466713_006966 Ga0466713_006966_14831_15253 140
62 3300042604 Ga0466717_244571 Ga0466717_244571_628_1050 140
63 3300042605 Ga0466716_349737 Ga0466716_349737_14156_14578 140
64 3300042615 Ga0466711_004876 Ga0466711_004876_5947_6369 140
65 3300042615 Ga0466711_025328 Ga0466711_025328_5458_5901 140
66 3300042618 Ga0466723_086277 Ga0466723_086277_2107_2529 140
67 3300042618 Ga0466723_193043 Ga0466723_193043_15338_15760 140
68 3300042619 Ga0466726_284900 Ga0466726_284900_1007_1429 140
69 3300042621 Ga0466729_166751 Ga0466729_166751_1246_1668 140
70 3300042643 Ga0466704_146857 Ga0466704_146857_9672_10094 140
71 3300042643 Ga0466704_352259 Ga0466704_352259_5116_5538 140
72 3300042648 Ga0466709_419248 Ga0466709_419248_1409_1831 140
73 3300042655 Ga0466727_150494 Ga0466727_150494_330_752 140
74 3300042659 Ga0466733_174129 Ga0466733_174129_16648_17070 140
75 iso_pr_bacteria 2923982719 2923983577 140
76 iso_pr_bacteria 2940202316 2940204762 140
77 iso_pr_bacteria 2940371297 2940371508 140
78 3300002504 JGI24705J35276_12219717 JGI24705J35276_122197173 141
79 3300002504 JGI24705J35276_12238425 JGI24705J35276_122384254 141
80 3300002834 JGI24696J40584_12606662 JGI24696J40584_126066621 141
81 3300002834 JGI24696J40584_12881119 JGI24696J40584_128811191 141
82 3300005083 Ga0068305_10060045 Ga0068305_100600458 141
83 3300042590 Ga0466690_059176 Ga0466690_059176_76_501 141
84 3300042593 Ga0466691_043152 Ga0466691_043152_2550_2975 141
85 3300042602 Ga0466713_020992 Ga0466713_020992_35410_35835 141
86 3300042605 Ga0466716_061788 Ga0466716_061788_1480_1905 141
87 3300042605 Ga0466716_195372 Ga0466716_195372_10401_10826 141
88 3300042606 Ga0466719_237679 Ga0466719_237679_10_435 141
89 3300042621 Ga0466729_112099 Ga0466729_112099_11645_12070 141
90 3300042643 Ga0466704_084380 Ga0466704_084380_12920_13345 141
91 3300042659 Ga0466733_120112 Ga0466733_120112_97202_97627 141
92 iso_pr_bacteria 2940205530 2940206480 141
93 iso_pr_bacteria 2940212447 2940213246 141
94 iso_pr_bacteria 2940298504 2940299450 141
95 iso_pr_bacteria 2940302308 2940303107 141
96 iso_pr_bacteria 2940306115 2940306979 141
97 iso_pr_bacteria 2940309933 2940310796 141
98 iso_pr_bacteria 2940313741 2940314489 141
99 iso_pr_bacteria 2940317558 2940318303 141
100 iso_pr_bacteria 2940321370 2940322116 141
101 iso_pr_bacteria 2940325180 2940325979 141
102 iso_pr_bacteria 2940328985 2940329934 141
103 iso_pr_bacteria 2940332795 2940333659 141
104 2225789004 2227222480 2227655958 142
105 3300002462 JGI24702J35022_10033559 JGI24702J35022_100335593 142
106 3300005083 Ga0068305_10069228 Ga0068305_1006922812 142
107 3300042606 Ga0466719_173135 Ga0466719_173135_1022_1450 142
108 3300042609 Ga0466722_154973 Ga0466722_154973_1454_1882 142
109 3300042612 Ga0466705_198378 Ga0466705_198378_2068_2496 142
110 3300042616 Ga0466715_047082 Ga0466715_047082_28410_28838 142
111 3300042616 Ga0466715_516781 Ga0466715_516781_11112_11540 142
112 3300042655 Ga0466727_075374 Ga0466727_075374_6528_6956 142
113 3300000062 IMNBL1DRAFT_c0001868 IMNBL1DRAFT_00018684 143
114 3300007149 Ga0104040_1144528 Ga0104040_11445283 143
115 3300009784 Ga0123357_10276420 Ga0123357_102764203 143
116 3300010049 Ga0123356_10649873 Ga0123356_106498733 143
117 3300042599 Ga0466706_192668 Ga0466706_192668_16984_17415 143
118 3300042615 Ga0466711_222547 Ga0466711_222547_7318_7749 143
119 3300042624 Ga0466735_168994 Ga0466735_168994_270_701 143
120 3300042636 Ga0466703_214432 Ga0466703_214432_61_492 143
121 3300056842 Ga0562377_0004 Ga0562377_0004_3331487_3331918 143
122 iso_pr_bacteria 2695420317 2695483575 143
123 iso_pr_bacteria 2873600114 2873601756 143
124 iso_pr_bacteria 2873610414 2873612137 143
125 iso_pr_bacteria 8100157865 8100159142 143
126 3300010049 Ga0123356_10490245 Ga0123356_104902452 144
127 3300042612 Ga0466705_326106 Ga0466705_326106_12455_12889 144
128 iso_pr_bacteria 2910930387 2910932803 144
129 3300010049 Ga0123356_10019680 Ga0123356_100196804 145
130 3300010049 Ga0123356_12208463 Ga0123356_122084632 145
131 3300010167 Ga0123353_12849769 Ga0123353_128497691 145
132 3300042643 Ga0466704_295144 Ga0466704_295144_1282_1719 145
133 3300010049 Ga0123356_10684155 Ga0123356_106841553 146
134 3300010167 Ga0123353_10420174 Ga0123353_104201741 146
135 3300042594 Ga0466694_251173 Ga0466694_251173_1140_1580 146
136 3300042612 Ga0466705_406286 Ga0466705_406286_210_650 146
137 3300042616 Ga0466715_397790 Ga0466715_397790_614_1054 146
138 iso_pr_bacteria 2820776227 2820777752 146
139 3300009784 Ga0123357_10006062 Ga0123357_100060629 147
140 3300010167 Ga0123353_10281216 Ga0123353_102812162 147
141 3300010167 Ga0123353_11260526 Ga0123353_112605262 147
142 3300010167 Ga0123353_11355857 Ga0123353_113558571 147
143 3300042590 Ga0466690_333134 Ga0466690_333134_6659_7102 147
144 3300042612 Ga0466705_057888 Ga0466705_057888_8487_8930 147
145 3300042643 Ga0466704_119527 Ga0466704_119527_8855_9298 147
146 3300010167 Ga0123353_13147010 Ga0123353_131470101 148
147 3300042596 Ga0466696_117205 Ga0466696_117205_1678_2127 149
148 3300042615 Ga0466711_039763 Ga0466711_039763_7761_8210 149
149 3300009784 Ga0123357_10289213 Ga0123357_102892133 150
150 3300042590 Ga0466690_292067 Ga0466690_292067_433_885 150
151 3300009784 Ga0123357_10592070 Ga0123357_105920702 151
152 3300042624 Ga0466735_113870 Ga0466735_113870_2465_2920 151
153 3300002462 JGI24702J35022_10125593 JGI24702J35022_101255932 152
154 3300042616 Ga0466715_642375 Ga0466715_642375_2437_2895 152
155 3300009784 Ga0123357_10683620 Ga0123357_106836202 153
156 3300010167 Ga0123353_10362377 Ga0123353_103623772 153
157 3300042599 Ga0466706_163843 Ga0466706_163843_2725_3192 155
158 3300042616 Ga0466715_186828 Ga0466715_186828_4699_5172 157
159 3300042636 Ga0466703_160950 Ga0466703_160950_5180_5701 173

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03652 RuvX Holliday junction resolvase 19 150 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03652 GO:0006364 rRNA processing BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.