Protein Family IF07688
Metagenome
Isolate
359
Members
143
Samples
297
Scaffolds
126.35
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_178014|Ga0466715_178014_2963_3421
- Length
- 152 aa
- Sequence
- LPGSEKKYNFAAKALQHITNTINITLKSMNFPTNLKYTKDHEWIRVEGNEAYVGITDYAQSELGEIVFVDIPTTGETLAKESVFGTIEAVKTVSDLFMPIAGEVLETNPHLEENPELVNEDAYGKGWLIRITVADPAELNELLSAAEYEEII
Sample Types
Isolate
17.3%
Metagenome
82.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.1%
Blattidae
16.5%
Kalotermitidae
10.5%
Unclassified
7.5%
Elmidae
6.8%
Armadillidiidae
5.3%
Culicidae
5.3%
Formicidae
4.5%
Drosophilidae
3.8%
Apidae
3.0%
Passalidae
3.0%
Cryptocercidae
3.0%
Termopsidae
3.0%
Rhinotermitidae
2.3%
Hodotermitidae
0.8%
Daphniidae
0.8%
Tenebrionidae
0.8%
Bombycidae
0.8%
Cambaridae
0.8%
Nephropidae
0.8%
Taxonomy
Archaea
0
Bacteria
346
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 2 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 5 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 16 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 17 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 18 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 19 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 20 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 21 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 22 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 23 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 24 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 25 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 26 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 32 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 33 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 34 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 44 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 45 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 46 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 47 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 48 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 49 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 50 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 51 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 52 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 53 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 54 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 55 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 56 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 59 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 60 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 61 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 62 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 63 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 64 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 65 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 66 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 67 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 68 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 69 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 70 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 71 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 72 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 73 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 74 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 75 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 76 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 77 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 78 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 79 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 80 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 81 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 82 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 83 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 84 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 85 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 86 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 87 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 88 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 89 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 90 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 91 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 92 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 93 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 94 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 95 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 96 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 97 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 98 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 99 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 100 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 101 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 102 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 103 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 104 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 105 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 106 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 107 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 108 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 109 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 110 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 111 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 112 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 113 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 114 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 115 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 116 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 117 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 118 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 119 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 120 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 121 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 122 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 123 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 124 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 125 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 126 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 127 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 128 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 129 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 130 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 131 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 132 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 133 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 134 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 135 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 136 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 137 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 138 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 139 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 140 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 141 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 142 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 143 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_020625 | 3300042612 | Bacteria | 6839 |
| 2 | Ga0466705_238035 | 3300042612 | Bacteria | 7385 |
| 3 | Ga0466733_047697 | 3300042659 | Bacteria | 13916 |
| 4 | Ga0466733_061651 | 3300042659 | Bacteria | 5014 |
| 5 | Ga0160453_100018 | 3300012814 | Bacteria | 253724 |
| 6 | Ga0160460_100013 | 3300012845 | Bacteria | 460073 |
| 7 | Ga0160445_101584 | 3300012847 | Unclassified | 6209 |
| 8 | Ga0265387_1062952 | 3300024582 | Bacteria | 696 |
| 9 | Ga0466690_090860 | 3300042590 | Bacteria | 14173 |
| 10 | Ga0466690_129614 | 3300042590 | Bacteria | 15151 |
| 11 | Ga0466690_192844 | 3300042590 | Bacteria | 1130 |
| 12 | Ga0466696_172183 | 3300042596 | Bacteria | 3258 |
| 13 | Ga0466711_293181 | 3300042615 | Bacteria | 11408 |
| 14 | Ga0466715_178014 | 3300042616 | Bacteria | 18736 |
| 15 | Ga0123354_10203860 | 3300010882 | Bacteria | 2163 |
| 16 | IMNBGM34_c010280 | 3300000036 | Bacteria | 1181 |
| 17 | IMNBGM34_c029873 | 3300000036 | Bacteria | 691 |
| 18 | IMNBL1DRAFT_c0007969 | 3300000062 | Bacteria | 5468 |
| 19 | JGI24702J35022_10457598 | 3300002462 | Bacteria | 778 |
| 20 | Ga0104045_1003531 | 3300007085 | Bacteria | 29239 |
| 21 | Ga0104048_1000658 | 3300007143 | Bacteria | 16188 |
| 22 | Ga0104050_1004260 | 3300007153 | Bacteria | 1940 |
| 23 | Ga0103267_1000139 | 3300007190 | Bacteria | 28036 |
| 24 | Ga0466734_084172 | 3300042623 | Bacteria | 1495 |
| 25 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 26 | Ga0466703_155663 | 3300042636 | Bacteria | 5304 |
| 27 | Ga0466703_402029 | 3300042636 | Bacteria | 8278 |
| 28 | Ga0466704_041653 | 3300042643 | Unclassified | 13209 |
| 29 | Ga0466709_260373 | 3300042648 | Bacteria | 3715 |
| 30 | Ga0466706_289878 | 3300042599 | Unclassified | 1058 |
| 31 | Ga0466707_368400 | 3300042601 | Bacteria | 6793 |
| 32 | Ga0466714_162257 | 3300042603 | Bacteria | 1034 |
| 33 | Ga0466719_146110 | 3300042606 | Bacteria | 1111 |
| 34 | Ga0466698_071599 | 3300042610 | Unclassified | 1028 |
| 35 | Ga0466697_196465 | 3300042611 | Bacteria | 1945 |
| 36 | Ga0466733_222616 | 3300042659 | Bacteria | 17707 |
| 37 | Ga0466696_147653 | 3300042596 | Bacteria | 4905 |
| 38 | Ga0466705_432765 | 3300042612 | Bacteria | 4695 |
| 39 | Ga0466711_078079 | 3300042615 | Bacteria | 1798 |
| 40 | Ga0466711_231558 | 3300042615 | Bacteria | 14810 |
| 41 | Ga0466711_387645 | 3300042615 | Bacteria | 5333 |
| 42 | Ga0466715_516443 | 3300042616 | Bacteria | 5241 |
| 43 | Ga0466729_178967 | 3300042621 | Bacteria | 10482 |
| 44 | Ga0123356_10105726 | 3300010049 | Bacteria | 2709 |
| 45 | Ga0123353_10010162 | 3300010167 | Bacteria | 13088 |
| 46 | Ga0123353_10039634 | 3300010167 | Bacteria | 7420 |
| 47 | Ga0123353_10356475 | 3300010167 | Bacteria | 2201 |
| 48 | Ga0123354_10147586 | 3300010882 | Bacteria | 2870 |
| 49 | Ga0123354_10245394 | 3300010882 | Unclassified | 1830 |
| 50 | Ga0123354_10762232 | 3300010882 | Unclassified | 660 |
| 51 | JGI24702J35022_10850925 | 3300002462 | Bacteria | 568 |
| 52 | Ga0068305_10001818 | 3300005083 | Bacteria | 2635 |
| 53 | Ga0074302_1151671 | 3300005316 | Bacteria | 771 |
| 54 | Ga0103268_1018173 | 3300007192 | Bacteria | 1562 |
| 55 | Ga0466703_142984 | 3300042636 | Bacteria | 1187 |
| 56 | Ga0466703_207218 | 3300042636 | Bacteria | 5283 |
| 57 | Ga0466704_020905 | 3300042643 | Bacteria | 8748 |
| 58 | Ga0466704_087409 | 3300042643 | Bacteria | 13449 |
| 59 | Ga0466704_316593 | 3300042643 | Bacteria | 7608 |
| 60 | Ga0466706_289870 | 3300042599 | Bacteria | 2711 |
| 61 | Ga0466713_153702 | 3300042602 | Bacteria | 29000 |
| 62 | Ga0466698_272349 | 3300042610 | Bacteria | 1578 |
| 63 | Ga0466705_050950 | 3300042612 | Bacteria | 13509 |
| 64 | Ga0466705_347583 | 3300042612 | Bacteria | 1317 |
| 65 | Ga0466733_123049 | 3300042659 | Bacteria | 21678 |
| 66 | Ga0160433_100376 | 3300012846 | Bacteria | 25407 |
| 67 | Ga0466690_009326 | 3300042590 | Bacteria | 10804 |
| 68 | Ga0466692_067935 | 3300042591 | Bacteria | 92005 |
| 69 | Ga0466691_027663 | 3300042593 | Bacteria | 17035 |
| 70 | Ga0466694_196309 | 3300042594 | Bacteria | 2995 |
| 71 | Ga0466695_356841 | 3300042595 | Bacteria | 1116 |
| 72 | Ga0466696_092633 | 3300042596 | Bacteria | 2147 |
| 73 | Ga0466696_282025 | 3300042596 | Bacteria | 14048 |
| 74 | Ga0466696_380451 | 3300042596 | Bacteria | 13335 |
| 75 | Ga0466696_387277 | 3300042596 | Bacteria | 1776 |
| 76 | Ga0466712_132348 | 3300042614 | Bacteria | 3356 |
| 77 | Ga0466711_424279 | 3300042615 | Bacteria | 19107 |
| 78 | Ga0466715_112294 | 3300042616 | Bacteria | 2416 |
| 79 | Ga0466723_041475 | 3300042618 | Bacteria | 4246 |
| 80 | Ga0466723_184511 | 3300042618 | Bacteria | 9601 |
| 81 | Ga0466726_111774 | 3300042619 | Bacteria | 6340 |
| 82 | Ga0466726_239072 | 3300042619 | Bacteria | 12220 |
| 83 | Ga0123357_10257021 | 3300009784 | Bacteria | 1855 |
| 84 | Ga0123355_10527594 | 3300009826 | Bacteria | 1441 |
| 85 | Ga0123356_10000665 | 3300010049 | Bacteria | 37938 |
| 86 | Ga0123356_10027559 | 3300010049 | Bacteria | 5322 |
| 87 | Ga0123356_10920486 | 3300010049 | Bacteria | 1045 |
| 88 | Ga0123356_12093283 | 3300010049 | Bacteria | 707 |
| 89 | Ga0123354_10001921 | 3300010882 | Bacteria | 26450 |
| 90 | Ga0123354_10002723 | 3300010882 | Bacteria | 23700 |
| 91 | 2227038711 | 2225789003 | Bacteria | 4298 |
| 92 | IMNBL1DRAFT_c0051048 | 3300000062 | Bacteria | 1305 |
| 93 | JGI24705J35276_11861905 | 3300002504 | Bacteria | 723 |
| 94 | Ga0068302_10905208 | 3300005071 | Bacteria | 583 |
| 95 | Ga0072941_1257348 | 3300005201 | Bacteria | 4361 |
| 96 | Ga0466724_22014 | 3300042649 | Bacteria | 158058 |
| 97 | Ga0466725_332846 | 3300042654 | Bacteria | 33341 |
| 98 | Ga0466727_064249 | 3300042655 | Bacteria | 3613 |
| 99 | Ga0466701_070735 | 3300042598 | Bacteria | 88417 |
| 100 | Ga0466700_088871 | 3300042600 | Bacteria | 6791 |
| 101 | Ga0466707_390074 | 3300042601 | Bacteria | 12329 |
| 102 | Ga0466713_003336 | 3300042602 | Bacteria | 78372 |
| 103 | Ga0466713_145405 | 3300042602 | Bacteria | 30268 |
| 104 | Ga0466719_512415 | 3300042606 | Bacteria | 1890 |
| 105 | Ga0466722_142327 | 3300042609 | Bacteria | 4305 |
| 106 | Ga0466722_159681 | 3300042609 | Bacteria | 66135 |
| 107 | Ga0466705_304109 | 3300042612 | Bacteria | 7024 |
| 108 | Ga0466733_123446 | 3300042659 | Bacteria | 50285 |
| 109 | Ga0160456_100170 | 3300012820 | Bacteria | 49232 |
| 110 | Ga0160460_100014 | 3300012845 | Bacteria | 440592 |
| 111 | Ga0466692_187233 | 3300042591 | Bacteria | 38333 |
| 112 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 113 | Ga0466696_177482 | 3300042596 | Bacteria | 10285 |
| 114 | Ga0466696_268297 | 3300042596 | Bacteria | 13144 |
| 115 | Ga0466701_002485 | 3300042598 | Bacteria | 3672 |
| 116 | Ga0466711_009001 | 3300042615 | Bacteria | 22653 |
| 117 | Ga0466711_159353 | 3300042615 | Bacteria | 25904 |
| 118 | Ga0466723_350546 | 3300042618 | Bacteria | 3962 |
| 119 | Ga0466726_008387 | 3300042619 | Bacteria | 4179 |
| 120 | Ga0123356_11269744 | 3300010049 | Bacteria | 900 |
| 121 | Ga0123353_11344917 | 3300010167 | Unclassified | 923 |
| 122 | IMNBL1DRAFT_c0007931 | 3300000062 | Bacteria | 5490 |
| 123 | Meta3P_1002643 | 3300002464 | Bacteria | 29387 |
| 124 | JGI24696J40584_12570302 | 3300002834 | Bacteria | 637 |
| 125 | Ga0072940_1195142 | 3300005200 | Bacteria | 796 |
| 126 | Ga0104048_1170277 | 3300007143 | Unclassified | 1723 |
| 127 | Ga0466729_294315 | 3300042621 | Bacteria | 2062 |
| 128 | Ga0466735_008418 | 3300042624 | Bacteria | 1315 |
| 129 | Ga0466735_091666 | 3300042624 | Bacteria | 4215 |
| 130 | Ga0466735_144716 | 3300042624 | Bacteria | 3299 |
| 131 | Ga0466730_103184 | 3300042625 | Bacteria | 430539 |
| 132 | Ga0466703_060318 | 3300042636 | Bacteria | 13180 |
| 133 | Ga0466703_191287 | 3300042636 | Bacteria | 3100 |
| 134 | Ga0466704_099577 | 3300042643 | Bacteria | 9180 |
| 135 | Ga0466704_187406 | 3300042643 | Bacteria | 10174 |
| 136 | Ga0466704_486310 | 3300042643 | Bacteria | 39029 |
| 137 | Ga0466704_570545 | 3300042643 | Bacteria | 8929 |
| 138 | Ga0466724_41309 | 3300042649 | Bacteria | 27934 |
| 139 | Ga0466708_251397 | 3300042652 | Bacteria | 44594 |
| 140 | Ga0466708_295697 | 3300042652 | Bacteria | 19378 |
| 141 | Ga0466725_037692 | 3300042654 | Bacteria | 1408 |
| 142 | Ga0466706_117275 | 3300042599 | Bacteria | 37384 |
| 143 | Ga0466700_452740 | 3300042600 | Bacteria | 3472 |
| 144 | Ga0466713_066012 | 3300042602 | Bacteria | 3740 |
| 145 | Ga0466717_223659 | 3300042604 | Bacteria | 1584 |
| 146 | Ga0466716_248151 | 3300042605 | Bacteria | 5756 |
| 147 | Ga0466719_107026 | 3300042606 | Bacteria | 8857 |
| 148 | Ga0466722_167338 | 3300042609 | Bacteria | 21617 |
| 149 | Ga0466705_111062 | 3300042612 | Bacteria | 3120 |
| 150 | Ga0466705_313250 | 3300042612 | Bacteria | 19074 |
| 151 | Ga0466733_094725 | 3300042659 | Bacteria | 1736 |
| 152 | Ga0466733_220429 | 3300042659 | Bacteria | 5014 |
| 153 | Ga0160459_100019 | 3300012831 | Bacteria | 370950 |
| 154 | Ga0160455_100073 | 3300012837 | Bacteria | 176825 |
| 155 | Ga0160433_100030 | 3300012846 | Bacteria | 173311 |
| 156 | Ga0160443_100026 | 3300012848 | Bacteria | 373861 |
| 157 | Ga0466657_250983 | 3300042582 | Bacteria | 7232 |
| 158 | Ga0466690_018670 | 3300042590 | Bacteria | 64858 |
| 159 | Ga0466690_026402 | 3300042590 | Bacteria | 15626 |
| 160 | Ga0466705_516223 | 3300042612 | Bacteria | 13598 |
| 161 | Ga0466711_310276 | 3300042615 | Bacteria | 7852 |
| 162 | Ga0466711_455196 | 3300042615 | Bacteria | 4416 |
| 163 | Ga0466723_243433 | 3300042618 | Bacteria | 45738 |
| 164 | Ga0466729_009851 | 3300042621 | Bacteria | 13606 |
| 165 | Ga0123357_10125487 | 3300009784 | Bacteria | 3217 |
| 166 | Ga0123356_13084769 | 3300010049 | Bacteria | 581 |
| 167 | Ga0123354_10007001 | 3300010882 | Bacteria | 16861 |
| 168 | JGI24705J35276_12231520 | 3300002504 | Bacteria | 3968 |
| 169 | Ga0103265_1027523 | 3300007068 | Unclassified | 761 |
| 170 | Ga0123357_10002416 | 3300009784 | Bacteria | 20828 |
| 171 | Ga0466735_157464 | 3300042624 | Bacteria | 6314 |
| 172 | Ga0466703_001188 | 3300042636 | Bacteria | 16315 |
| 173 | Ga0466704_347428 | 3300042643 | Bacteria | 8993 |
| 174 | Ga0466704_347546 | 3300042643 | Bacteria | 9629 |
| 175 | Ga0466709_202465 | 3300042648 | Bacteria | 29781 |
| 176 | Ga0466724_09840 | 3300042649 | Unclassified | 12034 |
| 177 | Ga0466708_250128 | 3300042652 | Bacteria | 4257 |
| 178 | Ga0466701_036999 | 3300042598 | Bacteria | 203039 |
| 179 | Ga0466706_073787 | 3300042599 | Bacteria | 1443 |
| 180 | Ga0466713_146043 | 3300042602 | Bacteria | 1597 |
| 181 | Ga0466714_069762 | 3300042603 | Bacteria | 1592 |
| 182 | Ga0466717_185060 | 3300042604 | Bacteria | 2474 |
| 183 | Ga0466719_083478 | 3300042606 | Bacteria | 6437 |
| 184 | Ga0466698_388521 | 3300042610 | Bacteria | 1718 |
| 185 | Ga0466733_000565 | 3300042659 | Bacteria | 1207 |
| 186 | Ga0160468_106964 | 3300012819 | Unclassified | 1200 |
| 187 | Ga0160445_100119 | 3300012847 | Bacteria | 69517 |
| 188 | Ga0160457_1000602 | 3300012858 | Bacteria | 14569 |
| 189 | Ga0265387_1007702 | 3300024582 | Bacteria | 1447 |
| 190 | Ga0466657_182735 | 3300042582 | Bacteria | 91898 |
| 191 | Ga0466690_011005 | 3300042590 | Bacteria | 3517 |
| 192 | Ga0466691_044030 | 3300042593 | Bacteria | 16870 |
| 193 | Ga0466694_264742 | 3300042594 | Bacteria | 1888 |
| 194 | Ga0466695_255306 | 3300042595 | Bacteria | 1478 |
| 195 | Ga0466696_227064 | 3300042596 | Bacteria | 35618 |
| 196 | Ga0466715_398920 | 3300042616 | Bacteria | 10835 |
| 197 | Ga0466718_170212 | 3300042617 | Bacteria | 3521 |
| 198 | Ga0466726_277506 | 3300042619 | Bacteria | 13542 |
| 199 | Ga0123355_11134153 | 3300009826 | Bacteria | 808 |
| 200 | Ga0123353_10083564 | 3300010167 | Bacteria | 5138 |
| 201 | Ga0123353_10427637 | 3300010167 | Bacteria | 1960 |
| 202 | Ga0123354_10318140 | 3300010882 | Bacteria | 1441 |
| 203 | 2227566289 | 2225789004 | Bacteria | 14266 |
| 204 | IMNBGM34_c001123 | 3300000036 | Bacteria | 5198 |
| 205 | HBC_ctgsDRAFT_1000033 | 3300000333 | Bacteria | 34495 |
| 206 | JGI24696J40584_12833006 | 3300002834 | Bacteria | 935 |
| 207 | Ga0068302_10262355 | 3300005071 | Bacteria | 2430 |
| 208 | Ga0104045_1019624 | 3300007085 | Bacteria | 3258 |
| 209 | Ga0103267_1001430 | 3300007190 | Bacteria | 5943 |
| 210 | Ga0466735_174280 | 3300042624 | Bacteria | 1020 |
| 211 | Ga0466730_020292 | 3300042625 | Bacteria | 1091 |
| 212 | Ga0466708_021985 | 3300042652 | Bacteria | 3040 |
| 213 | Ga0466708_119388 | 3300042652 | Bacteria | 3527 |
| 214 | Ga0466708_290494 | 3300042652 | Bacteria | 24158 |
| 215 | Ga0466701_098571 | 3300042598 | Bacteria | 9394 |
| 216 | Ga0466706_230288 | 3300042599 | Bacteria | 2724 |
| 217 | Ga0466714_061020 | 3300042603 | Bacteria | 5005 |
| 218 | Ga0466716_104532 | 3300042605 | Bacteria | 5986 |
| 219 | Ga0466697_109883 | 3300042611 | Bacteria | 2052 |
| 220 | Ga0466705_173968 | 3300042612 | Bacteria | 9238 |
| 221 | Ga0466690_018429 | 3300042590 | Bacteria | 4920 |
| 222 | Ga0466696_055683 | 3300042596 | Bacteria | 6781 |
| 223 | Ga0466696_278727 | 3300042596 | Bacteria | 1612 |
| 224 | Ga0466715_376227 | 3300042616 | Bacteria | 52075 |
| 225 | Ga0466715_538212 | 3300042616 | Bacteria | 5401 |
| 226 | Ga0466723_048973 | 3300042618 | Bacteria | 18505 |
| 227 | Ga0123357_10162160 | 3300009784 | Bacteria | 2676 |
| 228 | Ga0123355_10000198 | 3300009826 | Bacteria | 74850 |
| 229 | Ga0123356_10095297 | 3300010049 | Bacteria | 2845 |
| 230 | Ga0123356_10458309 | 3300010049 | Unclassified | 1424 |
| 231 | Ga0123356_10858406 | 3300010049 | Bacteria | 1079 |
| 232 | Ga0160454_100003 | 3300012798 | Bacteria | 498364 |
| 233 | 2227130807 | 2225789004 | Bacteria | 8952 |
| 234 | IMNBGM34_c031117 | 3300000036 | Bacteria | 678 |
| 235 | JGI24702J35022_10015008 | 3300002462 | Bacteria | 4269 |
| 236 | JGI24705J35276_11962297 | 3300002504 | Bacteria | 806 |
| 237 | JGI24705J35276_12197509 | 3300002504 | Bacteria | 1556 |
| 238 | Ga0068302_10202762 | 3300005071 | Bacteria | 7390 |
| 239 | Ga0074308_1122888 | 3300005307 | Bacteria | 667 |
| 240 | Ga0102735_1002054 | 3300007080 | Bacteria | 3898 |
| 241 | Ga0104045_1004860 | 3300007085 | Bacteria | 2693 |
| 242 | Ga0102734_1000373 | 3300007129 | Bacteria | 42767 |
| 243 | Ga0104050_1000873 | 3300007153 | Bacteria | 5417 |
| 244 | Ga0466731_135492 | 3300042622 | Bacteria | 3242 |
| 245 | Ga0466704_372245 | 3300042643 | Bacteria | 13926 |
| 246 | Ga0466709_265168 | 3300042648 | Bacteria | 8445 |
| 247 | Ga0466709_314545 | 3300042648 | Bacteria | 211401 |
| 248 | Ga0466706_174173 | 3300042599 | Bacteria | 17937 |
| 249 | Ga0466713_121438 | 3300042602 | Bacteria | 6968 |
| 250 | Ga0466714_144338 | 3300042603 | Bacteria | 4969 |
| 251 | Ga0466716_049545 | 3300042605 | Bacteria | 12218 |
| 252 | Ga0466719_188777 | 3300042606 | Bacteria | 12174 |
| 253 | Ga0466719_286817 | 3300042606 | Bacteria | 1854 |
| 254 | Ga0466722_269002 | 3300042609 | Bacteria | 4606 |
| 255 | Ga0466698_417151 | 3300042610 | Bacteria | 1253 |
| 256 | Ga0466697_226649 | 3300042611 | Bacteria | 1112 |
| 257 | Ga0466733_156455 | 3300042659 | Bacteria | 2947 |
| 258 | Ga0160456_103558 | 3300012820 | Bacteria | 2315 |
| 259 | Ga0415639_144714 | 3300038395 | Bacteria | 1090 |
| 260 | Ga0466657_400417 | 3300042582 | Bacteria | 2918 |
| 261 | Ga0466690_221148 | 3300042590 | Bacteria | 8102 |
| 262 | Ga0466692_120298 | 3300042591 | Bacteria | 1800 |
| 263 | Ga0466728_055345 | 3300042620 | Bacteria | 34961 |
| 264 | Ga0466729_138007 | 3300042621 | Bacteria | 2253 |
| 265 | Ga0123355_10008090 | 3300009826 | Bacteria | 15867 |
| 266 | Ga0123355_11502754 | 3300009826 | Bacteria | 657 |
| 267 | Ga0123356_10090005 | 3300010049 | Bacteria | 2921 |
| 268 | Ga0123356_10889606 | 3300010049 | Bacteria | 1062 |
| 269 | Ga0123356_11670228 | 3300010049 | Bacteria | 790 |
| 270 | Ga0123356_12220044 | 3300010049 | Bacteria | 686 |
| 271 | Ga0123356_12712572 | 3300010049 | Bacteria | 620 |
| 272 | Ga0123353_10206736 | 3300010167 | Bacteria | 3083 |
| 273 | Ga0123354_10164689 | 3300010882 | Bacteria | 2613 |
| 274 | IMNBGM34_c000257 | 3300000036 | Bacteria | 15334 |
| 275 | IMNBL1DRAFT_c0014405 | 3300000062 | Bacteria | 3493 |
| 276 | JGI24702J35022_10014586 | 3300002462 | Bacteria | 4334 |
| 277 | JGI24699J35502_11134066 | 3300002509 | Bacteria | 28043 |
| 278 | JGI24699J35502_11134174 | 3300002509 | Unclassified | 44505 |
| 279 | JGI24696J40584_12731287 | 3300002834 | Bacteria | 770 |
| 280 | Ga0102740_1000238 | 3300007140 | Bacteria | 15885 |
| 281 | Ga0123357_10002775 | 3300009784 | Bacteria | 19755 |
| 282 | Ga0466734_116993 | 3300042623 | Bacteria | 8423 |
| 283 | Ga0466735_034971 | 3300042624 | Bacteria | 4166 |
| 284 | Ga0466703_014132 | 3300042636 | Bacteria | 14492 |
| 285 | Ga0466703_305540 | 3300042636 | Bacteria | 6224 |
| 286 | Ga0466704_224378 | 3300042643 | Bacteria | 27509 |
| 287 | Ga0466704_271143 | 3300042643 | Bacteria | 4020 |
| 288 | Ga0466727_225673 | 3300042655 | Bacteria | 2033 |
| 289 | Ga0466701_095833 | 3300042598 | Bacteria | 9388 |
| 290 | Ga0466707_396626 | 3300042601 | Bacteria | 7136 |
| 291 | Ga0466713_035671 | 3300042602 | Bacteria | 26418 |
| 292 | Ga0466713_067722 | 3300042602 | Bacteria | 1804 |
| 293 | Ga0466714_001036 | 3300042603 | Bacteria | 4364 |
| 294 | Ga0466716_329110 | 3300042605 | Bacteria | 3054 |
| 295 | Ga0466719_158771 | 3300042606 | Bacteria | 2036 |
| 296 | Ga0466722_090557 | 3300042609 | Bacteria | 30177 |
| 297 | Ga0466722_121565 | 3300042609 | Bacteria | 2830 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042594 | Ga0466694_196309 | Ga0466694_196309_2042_2413 | 123 |
| 2 | 2225789004 | 2227566289 | 2228107864 | 124 |
| 3 | 3300042590 | Ga0466690_026402 | Ga0466690_026402_8032_8406 | 124 |
| 4 | 3300042590 | Ga0466690_090860 | Ga0466690_090860_559_933 | 124 |
| 5 | 3300042590 | Ga0466690_129614 | Ga0466690_129614_397_771 | 124 |
| 6 | 3300042591 | Ga0466692_067935 | Ga0466692_067935_12271_12645 | 124 |
| 7 | 3300042591 | Ga0466692_187233 | Ga0466692_187233_15996_16370 | 124 |
| 8 | 3300042593 | Ga0466691_027663 | Ga0466691_027663_14205_14579 | 124 |
| 9 | 3300042596 | Ga0466696_014961 | Ga0466696_014961_53385_53759 | 124 |
| 10 | 3300042598 | Ga0466701_002485 | Ga0466701_002485_2974_3348 | 124 |
| 11 | 3300042599 | Ga0466706_117275 | Ga0466706_117275_23018_23392 | 124 |
| 12 | 3300042604 | Ga0466717_223659 | Ga0466717_223659_317_691 | 124 |
| 13 | 3300042605 | Ga0466716_049545 | Ga0466716_049545_5009_5383 | 124 |
| 14 | 3300042605 | Ga0466716_104532 | Ga0466716_104532_1193_1567 | 124 |
| 15 | 3300042605 | Ga0466716_248151 | Ga0466716_248151_2345_2719 | 124 |
| 16 | 3300042606 | Ga0466719_083478 | Ga0466719_083478_1280_1654 | 124 |
| 17 | 3300042609 | Ga0466722_090557 | Ga0466722_090557_12174_12548 | 124 |
| 18 | 3300042609 | Ga0466722_167338 | Ga0466722_167338_12554_12928 | 124 |
| 19 | 3300042615 | Ga0466711_078079 | Ga0466711_078079_1302_1676 | 124 |
| 20 | 3300042615 | Ga0466711_231558 | Ga0466711_231558_8044_8418 | 124 |
| 21 | 3300042615 | Ga0466711_293181 | Ga0466711_293181_6982_7356 | 124 |
| 22 | 3300042615 | Ga0466711_310276 | Ga0466711_310276_2798_3172 | 124 |
| 23 | 3300042615 | Ga0466711_455196 | Ga0466711_455196_3827_4201 | 124 |
| 24 | 3300042616 | Ga0466715_398920 | Ga0466715_398920_2612_2986 | 124 |
| 25 | 3300042617 | Ga0466718_170212 | Ga0466718_170212_811_1185 | 124 |
| 26 | 3300042618 | Ga0466723_184511 | Ga0466723_184511_8974_9348 | 124 |
| 27 | 3300042618 | Ga0466723_243433 | Ga0466723_243433_14247_14621 | 124 |
| 28 | 3300042621 | Ga0466729_138007 | Ga0466729_138007_956_1330 | 124 |
| 29 | 3300042624 | Ga0466735_034971 | Ga0466735_034971_680_1054 | 124 |
| 30 | 3300042624 | Ga0466735_091666 | Ga0466735_091666_2905_3279 | 124 |
| 31 | 3300042636 | Ga0466703_060318 | Ga0466703_060318_5041_5415 | 124 |
| 32 | 3300042636 | Ga0466703_191287 | Ga0466703_191287_1863_2237 | 124 |
| 33 | 3300042636 | Ga0466703_402029 | Ga0466703_402029_2580_2954 | 124 |
| 34 | 3300042643 | Ga0466704_187406 | Ga0466704_187406_6595_6969 | 124 |
| 35 | 3300042648 | Ga0466709_260373 | Ga0466709_260373_1853_2227 | 124 |
| 36 | 3300042648 | Ga0466709_265168 | Ga0466709_265168_4945_5319 | 124 |
| 37 | 3300042652 | Ga0466708_295697 | Ga0466708_295697_2559_2933 | 124 |
| 38 | iso_pr_bacteria | 2832343623 | 2832344782 | 124 |
| 39 | iso_pr_bacteria | 2832372155 | 2832374270 | 124 |
| 40 | 3300000036 | IMNBGM34_c001123 | IMNBGM34_0011233 | 125 |
| 41 | 3300000062 | IMNBL1DRAFT_c0014405 | IMNBL1DRAFT_00144052 | 125 |
| 42 | 3300002834 | JGI24696J40584_12570302 | JGI24696J40584_125703022 | 125 |
| 43 | 3300005071 | Ga0068302_10202762 | Ga0068302_102027623 | 125 |
| 44 | 3300005071 | Ga0068302_10905208 | Ga0068302_109052081 | 125 |
| 45 | 3300009826 | Ga0123355_10000198 | Ga0123355_100001983 | 125 |
| 46 | 3300010049 | Ga0123356_10105726 | Ga0123356_101057262 | 125 |
| 47 | 3300010049 | Ga0123356_12093283 | Ga0123356_120932831 | 125 |
| 48 | 3300010882 | Ga0123354_10318140 | Ga0123354_103181403 | 125 |
| 49 | 3300038395 | Ga0415639_144714 | Ga0415639_144714_50_427 | 125 |
| 50 | 3300042582 | Ga0466657_182735 | Ga0466657_182735_89966_90343 | 125 |
| 51 | 3300042582 | Ga0466657_400417 | Ga0466657_400417_1763_2140 | 125 |
| 52 | 3300042590 | Ga0466690_009326 | Ga0466690_009326_2380_2757 | 125 |
| 53 | 3300042590 | Ga0466690_221148 | Ga0466690_221148_734_1111 | 125 |
| 54 | 3300042591 | Ga0466692_120298 | Ga0466692_120298_515_892 | 125 |
| 55 | 3300042596 | Ga0466696_177482 | Ga0466696_177482_2586_2963 | 125 |
| 56 | 3300042599 | Ga0466706_174173 | Ga0466706_174173_11129_11506 | 125 |
| 57 | 3300042601 | Ga0466707_390074 | Ga0466707_390074_8158_8535 | 125 |
| 58 | 3300042601 | Ga0466707_396626 | Ga0466707_396626_1147_1524 | 125 |
| 59 | 3300042602 | Ga0466713_153702 | Ga0466713_153702_136_513 | 125 |
| 60 | 3300042603 | Ga0466714_001036 | Ga0466714_001036_914_1291 | 125 |
| 61 | 3300042603 | Ga0466714_061020 | Ga0466714_061020_21_398 | 125 |
| 62 | 3300042603 | Ga0466714_069762 | Ga0466714_069762_1040_1417 | 125 |
| 63 | 3300042603 | Ga0466714_144338 | Ga0466714_144338_293_670 | 125 |
| 64 | 3300042603 | Ga0466714_162257 | Ga0466714_162257_169_546 | 125 |
| 65 | 3300042605 | Ga0466716_329110 | Ga0466716_329110_2411_2788 | 125 |
| 66 | 3300042606 | Ga0466719_107026 | Ga0466719_107026_1844_2221 | 125 |
| 67 | 3300042606 | Ga0466719_286817 | Ga0466719_286817_515_892 | 125 |
| 68 | 3300042609 | Ga0466722_121565 | Ga0466722_121565_1818_2195 | 125 |
| 69 | 3300042609 | Ga0466722_142327 | Ga0466722_142327_2290_2667 | 125 |
| 70 | 3300042610 | Ga0466698_071599 | Ga0466698_071599_284_661 | 125 |
| 71 | 3300042610 | Ga0466698_272349 | Ga0466698_272349_92_469 | 125 |
| 72 | 3300042610 | Ga0466698_388521 | Ga0466698_388521_1302_1679 | 125 |
| 73 | 3300042611 | Ga0466697_196465 | Ga0466697_196465_1205_1582 | 125 |
| 74 | 3300042611 | Ga0466697_226649 | Ga0466697_226649_212_589 | 125 |
| 75 | 3300042612 | Ga0466705_020625 | Ga0466705_020625_4514_4891 | 125 |
| 76 | 3300042612 | Ga0466705_313250 | Ga0466705_313250_15990_16367 | 125 |
| 77 | 3300042616 | Ga0466715_516443 | Ga0466715_516443_1103_1480 | 125 |
| 78 | 3300042616 | Ga0466715_538212 | Ga0466715_538212_1915_2292 | 125 |
| 79 | 3300042618 | Ga0466723_350546 | Ga0466723_350546_2616_2993 | 125 |
| 80 | 3300042619 | Ga0466726_008387 | Ga0466726_008387_3449_3826 | 125 |
| 81 | 3300042619 | Ga0466726_111774 | Ga0466726_111774_2064_2441 | 125 |
| 82 | 3300042619 | Ga0466726_277506 | Ga0466726_277506_1479_1856 | 125 |
| 83 | 3300042621 | Ga0466729_009851 | Ga0466729_009851_4321_4698 | 125 |
| 84 | 3300042623 | Ga0466734_084172 | Ga0466734_084172_1001_1378 | 125 |
| 85 | 3300042624 | Ga0466735_008418 | Ga0466735_008418_121_498 | 125 |
| 86 | 3300042624 | Ga0466735_174280 | Ga0466735_174280_94_471 | 125 |
| 87 | 3300042636 | Ga0466703_001188 | Ga0466703_001188_1635_2012 | 125 |
| 88 | 3300042636 | Ga0466703_014132 | Ga0466703_014132_4956_5333 | 125 |
| 89 | 3300042643 | Ga0466704_316593 | Ga0466704_316593_3707_4084 | 125 |
| 90 | 3300042649 | Ga0466724_22014 | Ga0466724_22014_149269_149646 | 125 |
| 91 | 3300042649 | Ga0466724_41309 | Ga0466724_41309_26732_27109 | 125 |
| 92 | 3300042652 | Ga0466708_251397 | Ga0466708_251397_33757_34134 | 125 |
| 93 | 3300042654 | Ga0466725_332846 | Ga0466725_332846_15136_15513 | 125 |
| 94 | 3300042655 | Ga0466727_064249 | Ga0466727_064249_2488_2865 | 125 |
| 95 | 3300042655 | Ga0466727_225673 | Ga0466727_225673_1004_1381 | 125 |
| 96 | 3300042659 | Ga0466733_156455 | Ga0466733_156455_2467_2844 | 125 |
| 97 | 3300042659 | Ga0466733_222616 | Ga0466733_222616_3308_3685 | 125 |
| 98 | iso_pr_bacteria | 2529292732 | 2529758711 | 125 |
| 99 | iso_pr_bacteria | 2687453786 | 2690174305 | 125 |
| 100 | iso_pr_bacteria | 2820741847 | 2820742062 | 125 |
| 101 | iso_pr_bacteria | 2847090942 | 2847092708 | 125 |
| 102 | iso_pr_bacteria | 2864788197 | 2864791589 | 125 |
| 103 | iso_pr_bacteria | 2864822740 | 2864826564 | 125 |
| 104 | iso_pr_bacteria | 2864882932 | 2864885964 | 125 |
| 105 | iso_pr_bacteria | 2864891731 | 2864895335 | 125 |
| 106 | iso_pr_bacteria | 2864923010 | 2864926403 | 125 |
| 107 | iso_pr_bacteria | 2864948220 | 2864951611 | 125 |
| 108 | iso_pr_bacteria | 2921902974 | 2921905365 | 125 |
| 109 | iso_pr_bacteria | 8020009074 | 8020011253 | 125 |
| 110 | iso_pr_bacteria | 8114076984 | 8114079218 | 125 |
| 111 | 2225789003 | 2227038711 | 2227398967 | 126 |
| 112 | 2225789004 | 2227130807 | 2227527806 | 126 |
| 113 | 3300000333 | HBC_ctgsDRAFT_1000033 | HBC_ctgsDRAFT_10000332 | 126 |
| 114 | 3300002464 | Meta3P_1002643 | Meta3P_100264310 | 126 |
| 115 | 3300002834 | JGI24696J40584_12731287 | JGI24696J40584_127312872 | 126 |
| 116 | 3300005071 | Ga0068302_10262355 | Ga0068302_102623552 | 126 |
| 117 | 3300007129 | Ga0102734_1000373 | Ga0102734_100037333 | 126 |
| 118 | 3300007190 | Ga0103267_1000139 | Ga0103267_100013915 | 126 |
| 119 | 3300009784 | Ga0123357_10162160 | Ga0123357_101621601 | 126 |
| 120 | 3300010049 | Ga0123356_10858406 | Ga0123356_108584062 | 126 |
| 121 | 3300010049 | Ga0123356_11269744 | Ga0123356_112697441 | 126 |
| 122 | 3300010049 | Ga0123356_13084769 | Ga0123356_130847691 | 126 |
| 123 | 3300010167 | Ga0123353_10010162 | Ga0123353_100101623 | 126 |
| 124 | 3300010167 | Ga0123353_11344917 | Ga0123353_113449172 | 126 |
| 125 | 3300010882 | Ga0123354_10147586 | Ga0123354_101475862 | 126 |
| 126 | 3300012819 | Ga0160468_106964 | Ga0160468_1069642 | 126 |
| 127 | 3300012820 | Ga0160456_103558 | Ga0160456_1035583 | 126 |
| 128 | 3300012845 | Ga0160460_100014 | Ga0160460_100014306 | 126 |
| 129 | 3300024582 | Ga0265387_1007702 | Ga0265387_10077023 | 126 |
| 130 | 3300024582 | Ga0265387_1062952 | Ga0265387_10629521 | 126 |
| 131 | 3300042590 | Ga0466690_018670 | Ga0466690_018670_31560_31940 | 126 |
| 132 | 3300042590 | Ga0466690_192844 | Ga0466690_192844_179_559 | 126 |
| 133 | 3300042595 | Ga0466695_255306 | Ga0466695_255306_1073_1453 | 126 |
| 134 | 3300042595 | Ga0466695_356841 | Ga0466695_356841_721_1101 | 126 |
| 135 | 3300042596 | Ga0466696_055683 | Ga0466696_055683_2132_2512 | 126 |
| 136 | 3300042596 | Ga0466696_092633 | Ga0466696_092633_1053_1433 | 126 |
| 137 | 3300042596 | Ga0466696_147653 | Ga0466696_147653_2768_3148 | 126 |
| 138 | 3300042596 | Ga0466696_172183 | Ga0466696_172183_2159_2539 | 126 |
| 139 | 3300042596 | Ga0466696_268297 | Ga0466696_268297_8734_9114 | 126 |
| 140 | 3300042596 | Ga0466696_278727 | Ga0466696_278727_313_693 | 126 |
| 141 | 3300042596 | Ga0466696_282025 | Ga0466696_282025_8887_9267 | 126 |
| 142 | 3300042596 | Ga0466696_380451 | Ga0466696_380451_8828_9208 | 126 |
| 143 | 3300042596 | Ga0466696_387277 | Ga0466696_387277_1253_1633 | 126 |
| 144 | 3300042598 | Ga0466701_036999 | Ga0466701_036999_157640_158020 | 126 |
| 145 | 3300042598 | Ga0466701_095833 | Ga0466701_095833_1510_1890 | 126 |
| 146 | 3300042598 | Ga0466701_098571 | Ga0466701_098571_1504_1884 | 126 |
| 147 | 3300042599 | Ga0466706_073787 | Ga0466706_073787_215_595 | 126 |
| 148 | 3300042599 | Ga0466706_289870 | Ga0466706_289870_1860_2240 | 126 |
| 149 | 3300042599 | Ga0466706_289878 | Ga0466706_289878_207_587 | 126 |
| 150 | 3300042600 | Ga0466700_088871 | Ga0466700_088871_2141_2521 | 126 |
| 151 | 3300042600 | Ga0466700_452740 | Ga0466700_452740_1819_2199 | 126 |
| 152 | 3300042601 | Ga0466707_368400 | Ga0466707_368400_2582_2962 | 126 |
| 153 | 3300042602 | Ga0466713_003336 | Ga0466713_003336_41012_41392 | 126 |
| 154 | 3300042602 | Ga0466713_035671 | Ga0466713_035671_16828_17208 | 126 |
| 155 | 3300042602 | Ga0466713_066012 | Ga0466713_066012_1428_1808 | 126 |
| 156 | 3300042602 | Ga0466713_067722 | Ga0466713_067722_329_709 | 126 |
| 157 | 3300042602 | Ga0466713_121438 | Ga0466713_121438_1219_1599 | 126 |
| 158 | 3300042602 | Ga0466713_145405 | Ga0466713_145405_29753_30133 | 126 |
| 159 | 3300042602 | Ga0466713_146043 | Ga0466713_146043_713_1093 | 126 |
| 160 | 3300042604 | Ga0466717_185060 | Ga0466717_185060_323_703 | 126 |
| 161 | 3300042606 | Ga0466719_188777 | Ga0466719_188777_791_1171 | 126 |
| 162 | 3300042609 | Ga0466722_159681 | Ga0466722_159681_18121_18501 | 126 |
| 163 | 3300042609 | Ga0466722_269002 | Ga0466722_269002_743_1123 | 126 |
| 164 | 3300042610 | Ga0466698_417151 | Ga0466698_417151_311_691 | 126 |
| 165 | 3300042612 | Ga0466705_050950 | Ga0466705_050950_3692_4072 | 126 |
| 166 | 3300042612 | Ga0466705_111062 | Ga0466705_111062_2068_2448 | 126 |
| 167 | 3300042612 | Ga0466705_173968 | Ga0466705_173968_7432_7812 | 126 |
| 168 | 3300042612 | Ga0466705_238035 | Ga0466705_238035_4613_4993 | 126 |
| 169 | 3300042612 | Ga0466705_347583 | Ga0466705_347583_674_1054 | 126 |
| 170 | 3300042614 | Ga0466712_132348 | Ga0466712_132348_1022_1402 | 126 |
| 171 | 3300042615 | Ga0466711_009001 | Ga0466711_009001_3877_4257 | 126 |
| 172 | 3300042615 | Ga0466711_159353 | Ga0466711_159353_19757_20137 | 126 |
| 173 | 3300042615 | Ga0466711_387645 | Ga0466711_387645_835_1215 | 126 |
| 174 | 3300042615 | Ga0466711_424279 | Ga0466711_424279_2350_2730 | 126 |
| 175 | 3300042616 | Ga0466715_376227 | Ga0466715_376227_12048_12428 | 126 |
| 176 | 3300042619 | Ga0466726_239072 | Ga0466726_239072_5119_5499 | 126 |
| 177 | 3300042620 | Ga0466728_055345 | Ga0466728_055345_20276_20656 | 126 |
| 178 | 3300042621 | Ga0466729_178967 | Ga0466729_178967_258_638 | 126 |
| 179 | 3300042621 | Ga0466729_294315 | Ga0466729_294315_1540_1920 | 126 |
| 180 | 3300042622 | Ga0466731_135492 | Ga0466731_135492_885_1265 | 126 |
| 181 | 3300042623 | Ga0466734_116993 | Ga0466734_116993_4019_4399 | 126 |
| 182 | 3300042624 | Ga0466735_144716 | Ga0466735_144716_2474_2854 | 126 |
| 183 | 3300042624 | Ga0466735_157464 | Ga0466735_157464_1781_2161 | 126 |
| 184 | 3300042625 | Ga0466730_079418 | Ga0466730_079418_443821_444201 | 126 |
| 185 | 3300042625 | Ga0466730_103184 | Ga0466730_103184_60924_61304 | 126 |
| 186 | 3300042636 | Ga0466703_142984 | Ga0466703_142984_596_976 | 126 |
| 187 | 3300042636 | Ga0466703_305540 | Ga0466703_305540_1644_2024 | 126 |
| 188 | 3300042643 | Ga0466704_020905 | Ga0466704_020905_2936_3316 | 126 |
| 189 | 3300042643 | Ga0466704_099577 | Ga0466704_099577_7732_8112 | 126 |
| 190 | 3300042643 | Ga0466704_224378 | Ga0466704_224378_11931_12311 | 126 |
| 191 | 3300042643 | Ga0466704_271143 | Ga0466704_271143_2090_2470 | 126 |
| 192 | 3300042643 | Ga0466704_347428 | Ga0466704_347428_3647_4027 | 126 |
| 193 | 3300042643 | Ga0466704_347546 | Ga0466704_347546_3628_4008 | 126 |
| 194 | 3300042643 | Ga0466704_372245 | Ga0466704_372245_6244_6624 | 126 |
| 195 | 3300042648 | Ga0466709_202465 | Ga0466709_202465_21943_22323 | 126 |
| 196 | 3300042649 | Ga0466724_09840 | Ga0466724_09840_8422_8802 | 126 |
| 197 | 3300042652 | Ga0466708_119388 | Ga0466708_119388_1316_1696 | 126 |
| 198 | 3300042652 | Ga0466708_250128 | Ga0466708_250128_831_1211 | 126 |
| 199 | 3300042652 | Ga0466708_290494 | Ga0466708_290494_2260_2640 | 126 |
| 200 | 3300042654 | Ga0466725_037692 | Ga0466725_037692_799_1179 | 126 |
| 201 | 3300042659 | Ga0466733_000565 | Ga0466733_000565_66_446 | 126 |
| 202 | 3300042659 | Ga0466733_061651 | Ga0466733_061651_2109_2489 | 126 |
| 203 | 3300042659 | Ga0466733_094725 | Ga0466733_094725_537_917 | 126 |
| 204 | 3300042659 | Ga0466733_123049 | Ga0466733_123049_18523_18903 | 126 |
| 205 | 3300042659 | Ga0466733_123446 | Ga0466733_123446_48258_48638 | 126 |
| 206 | 3300042659 | Ga0466733_220429 | Ga0466733_220429_4414_4794 | 126 |
| 207 | iso_pr_bacteria | 2811995047 | 2812947603 | 126 |
| 208 | iso_pr_bacteria | 2820058318 | 2820059747 | 126 |
| 209 | iso_pr_bacteria | 2820757377 | 2820759078 | 126 |
| 210 | iso_pr_bacteria | 2820759988 | 2820761664 | 126 |
| 211 | iso_pr_bacteria | 2820778767 | 2820780184 | 126 |
| 212 | iso_pr_bacteria | 2864836148 | 2864837952 | 126 |
| 213 | iso_pr_bacteria | 2864878056 | 2864879206 | 126 |
| 214 | iso_pr_bacteria | 2864886855 | 2864887106 | 126 |
| 215 | iso_pr_bacteria | 2864891731 | 2864894194 | 126 |
| 216 | iso_pr_bacteria | 2882250448 | 2882250921 | 126 |
| 217 | iso_pr_bacteria | 2882250448 | 2882252508 | 126 |
| 218 | iso_pr_bacteria | 2896321640 | 2896324175 | 126 |
| 219 | iso_pr_bacteria | 2896330536 | 2896332747 | 126 |
| 220 | iso_pr_bacteria | 2896350215 | 2896352560 | 126 |
| 221 | iso_pr_bacteria | 2898741527 | 2898744037 | 126 |
| 222 | iso_pr_bacteria | 2899132286 | 2899133426 | 126 |
| 223 | iso_pr_bacteria | 2920168565 | 2920170587 | 126 |
| 224 | iso_pr_bacteria | 2923982719 | 2923982979 | 126 |
| 225 | iso_pr_bacteria | 2940193328 | 2940195207 | 126 |
| 226 | iso_pr_bacteria | 2940195863 | 2940198580 | 126 |
| 227 | iso_pr_bacteria | 2940199050 | 2940202251 | 126 |
| 228 | iso_pr_bacteria | 2940202316 | 2940204639 | 126 |
| 229 | iso_pr_bacteria | 2940205530 | 2940206121 | 126 |
| 230 | iso_pr_bacteria | 2940209341 | 2940211881 | 126 |
| 231 | iso_pr_bacteria | 2940212447 | 2940213036 | 126 |
| 232 | iso_pr_bacteria | 2940298504 | 2940299092 | 126 |
| 233 | iso_pr_bacteria | 2940302308 | 2940302835 | 126 |
| 234 | iso_pr_bacteria | 2940306115 | 2940306243 | 126 |
| 235 | iso_pr_bacteria | 2940309933 | 2940310123 | 126 |
| 236 | iso_pr_bacteria | 2940313741 | 2940313933 | 126 |
| 237 | iso_pr_bacteria | 2940317558 | 2940317686 | 126 |
| 238 | iso_pr_bacteria | 2940321370 | 2940321561 | 126 |
| 239 | iso_pr_bacteria | 2940325180 | 2940325707 | 126 |
| 240 | iso_pr_bacteria | 2940328985 | 2940329513 | 126 |
| 241 | iso_pr_bacteria | 2940332795 | 2940332923 | 126 |
| 242 | iso_pr_bacteria | 2940336608 | 2940338477 | 126 |
| 243 | iso_pr_bacteria | 2940346213 | 2940348394 | 126 |
| 244 | iso_pr_bacteria | 2940371297 | 2940372749 | 126 |
| 245 | iso_pr_bacteria | 2998907766 | 2998909697 | 126 |
| 246 | iso_pr_bacteria | 8065497608 | 8065500266 | 126 |
| 247 | 3300000036 | IMNBGM34_c000257 | IMNBGM34_0002578 | 127 |
| 248 | 3300000036 | IMNBGM34_c010280 | IMNBGM34_0102801 | 127 |
| 249 | 3300000062 | IMNBL1DRAFT_c0007931 | IMNBL1DRAFT_00079313 | 127 |
| 250 | 3300000062 | IMNBL1DRAFT_c0007969 | IMNBL1DRAFT_00079693 | 127 |
| 251 | 3300000062 | IMNBL1DRAFT_c0051048 | IMNBL1DRAFT_00510483 | 127 |
| 252 | 3300002462 | JGI24702J35022_10014586 | JGI24702J35022_100145864 | 127 |
| 253 | 3300002462 | JGI24702J35022_10015008 | JGI24702J35022_100150086 | 127 |
| 254 | 3300002462 | JGI24702J35022_10457598 | JGI24702J35022_104575981 | 127 |
| 255 | 3300002462 | JGI24702J35022_10850925 | JGI24702J35022_108509251 | 127 |
| 256 | 3300002504 | JGI24705J35276_11861905 | JGI24705J35276_118619051 | 127 |
| 257 | 3300002504 | JGI24705J35276_11962297 | JGI24705J35276_119622971 | 127 |
| 258 | 3300002504 | JGI24705J35276_12197509 | JGI24705J35276_121975092 | 127 |
| 259 | 3300002509 | JGI24699J35502_11134066 | JGI24699J35502_111340669 | 127 |
| 260 | 3300002509 | JGI24699J35502_11134174 | JGI24699J35502_111341746 | 127 |
| 261 | 3300002834 | JGI24696J40584_12833006 | JGI24696J40584_128330062 | 127 |
| 262 | 3300005083 | Ga0068305_10001818 | Ga0068305_100018184 | 127 |
| 263 | 3300005201 | Ga0072941_1257348 | Ga0072941_12573482 | 127 |
| 264 | 3300005316 | Ga0074302_1151671 | Ga0074302_11516711 | 127 |
| 265 | 3300007068 | Ga0103265_1027523 | Ga0103265_10275231 | 127 |
| 266 | 3300007080 | Ga0102735_1002054 | Ga0102735_10020543 | 127 |
| 267 | 3300007085 | Ga0104045_1003531 | Ga0104045_10035318 | 127 |
| 268 | 3300007085 | Ga0104045_1004860 | Ga0104045_10048602 | 127 |
| 269 | 3300007085 | Ga0104045_1019624 | Ga0104045_10196244 | 127 |
| 270 | 3300007140 | Ga0102740_1000238 | Ga0102740_100023813 | 127 |
| 271 | 3300007143 | Ga0104048_1000658 | Ga0104048_100065814 | 127 |
| 272 | 3300007143 | Ga0104048_1170277 | Ga0104048_11702771 | 127 |
| 273 | 3300007153 | Ga0104050_1004260 | Ga0104050_10042603 | 127 |
| 274 | 3300007190 | Ga0103267_1001430 | Ga0103267_10014307 | 127 |
| 275 | 3300007192 | Ga0103268_1018173 | Ga0103268_10181732 | 127 |
| 276 | 3300009784 | Ga0123357_10002416 | Ga0123357_1000241614 | 127 |
| 277 | 3300009784 | Ga0123357_10002775 | Ga0123357_1000277511 | 127 |
| 278 | 3300010049 | Ga0123356_10458309 | Ga0123356_104583093 | 127 |
| 279 | 3300010049 | Ga0123356_10889606 | Ga0123356_108896062 | 127 |
| 280 | 3300010049 | Ga0123356_11670228 | Ga0123356_116702281 | 127 |
| 281 | 3300010049 | Ga0123356_12220044 | Ga0123356_122200441 | 127 |
| 282 | 3300010167 | Ga0123353_10083564 | Ga0123353_100835644 | 127 |
| 283 | 3300010167 | Ga0123353_10206736 | Ga0123353_102067362 | 127 |
| 284 | 3300010167 | Ga0123353_10356475 | Ga0123353_103564753 | 127 |
| 285 | 3300010167 | Ga0123353_10427637 | Ga0123353_104276373 | 127 |
| 286 | 3300010882 | Ga0123354_10001921 | Ga0123354_1000192116 | 127 |
| 287 | 3300010882 | Ga0123354_10002723 | Ga0123354_100027238 | 127 |
| 288 | 3300010882 | Ga0123354_10007001 | Ga0123354_100070018 | 127 |
| 289 | 3300010882 | Ga0123354_10164689 | Ga0123354_101646892 | 127 |
| 290 | 3300010882 | Ga0123354_10203860 | Ga0123354_102038603 | 127 |
| 291 | 3300010882 | Ga0123354_10245394 | Ga0123354_102453941 | 127 |
| 292 | 3300010882 | Ga0123354_10762232 | Ga0123354_107622321 | 127 |
| 293 | 3300012798 | Ga0160454_100003 | Ga0160454_100003406 | 127 |
| 294 | 3300012814 | Ga0160453_100018 | Ga0160453_100018172 | 127 |
| 295 | 3300012820 | Ga0160456_100170 | Ga0160456_10017040 | 127 |
| 296 | 3300012831 | Ga0160459_100019 | Ga0160459_10001972 | 127 |
| 297 | 3300012837 | Ga0160455_100073 | Ga0160455_10007393 | 127 |
| 298 | 3300012845 | Ga0160460_100013 | Ga0160460_10001333 | 127 |
| 299 | 3300012846 | Ga0160433_100030 | Ga0160433_10003095 | 127 |
| 300 | 3300012846 | Ga0160433_100376 | Ga0160433_10037610 | 127 |
| 301 | 3300012847 | Ga0160445_100119 | Ga0160445_10011953 | 127 |
| 302 | 3300012847 | Ga0160445_101584 | Ga0160445_1015844 | 127 |
| 303 | 3300012848 | Ga0160443_100026 | Ga0160443_100026273 | 127 |
| 304 | 3300012858 | Ga0160457_1000602 | Ga0160457_10006025 | 127 |
| 305 | 3300042590 | Ga0466690_011005 | Ga0466690_011005_2742_3125 | 127 |
| 306 | 3300042590 | Ga0466690_018429 | Ga0466690_018429_3545_3928 | 127 |
| 307 | 3300042593 | Ga0466691_044030 | Ga0466691_044030_4909_5292 | 127 |
| 308 | 3300042599 | Ga0466706_230288 | Ga0466706_230288_1458_1841 | 127 |
| 309 | 3300042606 | Ga0466719_146110 | Ga0466719_146110_577_960 | 127 |
| 310 | 3300042606 | Ga0466719_512415 | Ga0466719_512415_73_456 | 127 |
| 311 | 3300042611 | Ga0466697_109883 | Ga0466697_109883_574_957 | 127 |
| 312 | 3300042612 | Ga0466705_304109 | Ga0466705_304109_981_1364 | 127 |
| 313 | 3300042612 | Ga0466705_432765 | Ga0466705_432765_1176_1559 | 127 |
| 314 | 3300042612 | Ga0466705_516223 | Ga0466705_516223_11379_11762 | 127 |
| 315 | 3300042618 | Ga0466723_041475 | Ga0466723_041475_2927_3310 | 127 |
| 316 | 3300042636 | Ga0466703_155663 | Ga0466703_155663_2460_2843 | 127 |
| 317 | 3300042636 | Ga0466703_207218 | Ga0466703_207218_1555_1938 | 127 |
| 318 | 3300042643 | Ga0466704_041653 | Ga0466704_041653_11594_11977 | 127 |
| 319 | 3300042643 | Ga0466704_486310 | Ga0466704_486310_11461_11844 | 127 |
| 320 | 3300042648 | Ga0466709_314545 | Ga0466709_314545_64521_64904 | 127 |
| 321 | 3300042652 | Ga0466708_021985 | Ga0466708_021985_1760_2143 | 127 |
| 322 | 3300042659 | Ga0466733_047697 | Ga0466733_047697_4135_4518 | 127 |
| 323 | iso_pr_bacteria | 2838772460 | 2838773649 | 127 |
| 324 | 3300000036 | IMNBGM34_c029873 | IMNBGM34_0298731 | 128 |
| 325 | 3300000036 | IMNBGM34_c031117 | IMNBGM34_0311171 | 128 |
| 326 | 3300005307 | Ga0074308_1122888 | Ga0074308_11228882 | 128 |
| 327 | 3300009826 | Ga0123355_11502754 | Ga0123355_115027542 | 128 |
| 328 | 3300010049 | Ga0123356_10095297 | Ga0123356_100952973 | 128 |
| 329 | 3300010167 | Ga0123353_10039634 | Ga0123353_100396347 | 128 |
| 330 | 3300042582 | Ga0466657_250983 | Ga0466657_250983_5839_6225 | 128 |
| 331 | 3300042594 | Ga0466694_264742 | Ga0466694_264742_1219_1605 | 128 |
| 332 | 3300042596 | Ga0466696_227064 | Ga0466696_227064_2918_3304 | 128 |
| 333 | 3300042606 | Ga0466719_158771 | Ga0466719_158771_764_1150 | 128 |
| 334 | 3300042618 | Ga0466723_048973 | Ga0466723_048973_14679_15065 | 128 |
| 335 | 3300042625 | Ga0466730_020292 | Ga0466730_020292_397_786 | 129 |
| 336 | 3300042643 | Ga0466704_087409 | Ga0466704_087409_7936_8325 | 129 |
| 337 | 3300042643 | Ga0466704_570545 | Ga0466704_570545_6904_7293 | 129 |
| 338 | iso_pr_bacteria | 2820951912 | 2820954540 | 129 |
| 339 | 3300005200 | Ga0072940_1195142 | Ga0072940_11951421 | 130 |
| 340 | 3300009784 | Ga0123357_10125487 | Ga0123357_101254873 | 130 |
| 341 | 3300009784 | Ga0123357_10257021 | Ga0123357_102570211 | 130 |
| 342 | 3300009826 | Ga0123355_10008090 | Ga0123355_100080901 | 130 |
| 343 | 3300009826 | Ga0123355_10527594 | Ga0123355_105275942 | 130 |
| 344 | 3300009826 | Ga0123355_11134153 | Ga0123355_111341531 | 130 |
| 345 | 3300010049 | Ga0123356_10000665 | Ga0123356_1000066521 | 130 |
| 346 | 3300010049 | Ga0123356_10027559 | Ga0123356_100275593 | 130 |
| 347 | 3300010049 | Ga0123356_10090005 | Ga0123356_100900052 | 130 |
| 348 | 3300010049 | Ga0123356_10920486 | Ga0123356_109204862 | 130 |
| 349 | 3300010049 | Ga0123356_12712572 | Ga0123356_127125722 | 130 |
| 350 | 3300042598 | Ga0466701_070735 | Ga0466701_070735_9486_9878 | 130 |
| 351 | iso_pr_bacteria | 2833034481 | 2833034881 | 135 |
| 352 | iso_pr_bacteria | 2833044002 | 2833044402 | 135 |
| 353 | 3300007153 | Ga0104050_1000873 | Ga0104050_10008737 | 136 |
| 354 | iso_pr_bacteria | 2833037493 | 2833037900 | 136 |
| 355 | iso_pr_bacteria | 2833051446 | 2833051851 | 136 |
| 356 | 3300002504 | JGI24705J35276_12231520 | JGI24705J35276_122315202 | 138 |
| 357 | iso_pr_bacteria | 2579779088 | 2582239075 | 140 |
| 358 | 3300042616 | Ga0466715_112294 | Ga0466715_112294_1138_1569 | 143 |
| 359 | 3300042616 | Ga0466715_178014 | Ga0466715_178014_2963_3421 | 152 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01597 | GCV_H | Glycine cleavage H-protein | 35 | 151 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.