Protein Family IF07687

Metagenome Isolate
145 Members
50 Samples
132 Scaffolds
319.39 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_175784|Ga0466715_175784_2494_3504
Length
299 aa
Sequence
LRTHDPLFWEDARRAEVQMKTVRSLKKWIDLYKVVHDAAEELDLTFEYAKEGIASELEFRNMLREEADQMSCVLKINSGAGGTESQDWALMLMRMYMRWSESNGYKVGDYAYGYLKGENGVHRLVRVSPYNAQGKRMTSFASVFVAPLVDDTIEINIIPANISWDTFRSSGAGGQNVNKVESGVRLRYRYKDPYTGQEEEILIENTETRDQPKNRDNAMRHLRSILYDKEMQHRLAEKAKIESGKMKIEWGSQIRSYVFDDRRVKDHRTNYQTSDVNGVMDGKIDAFIKAYLMEFSESR

📊 Sample Types

Isolate 9.0%
Metagenome 91.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 28.0%
Blattidae 26.0%
Termitidae 22.0%
Termopsidae 6.0%
Unclassified 6.0%
Rhinotermitidae 6.0%
Passalidae 4.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
2 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
3 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
4 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
5 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
6 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
7 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
8 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
9 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
10 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
11 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
12 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
13 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
18 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
19 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
43 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
44 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
45 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
46 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
47 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_201614 3300042612 Bacteria 1520
2 Ga0466711_037934 3300042615 Bacteria 4226
3 Ga0466711_434385 3300042615 Bacteria 7629
4 Ga0466715_301112 3300042616 Bacteria 4887
5 Ga0466715_579190 3300042616 Bacteria 2131
6 Ga0466723_080576 3300042618 Bacteria 15425
7 Ga0466723_082277 3300042618 Bacteria 15970
8 Ga0466704_251609 3300042643 Bacteria 45182
9 Ga0466725_164174 3300042654 Bacteria 16518
10 Ga0466727_022134 3300042655 Bacteria 16946
11 Ga0466690_409563 3300042590 Bacteria 30321
12 Ga0466716_114211 3300042605 Bacteria 30877
13 Ga0466716_129240 3300042605 Bacteria 11148
14 Ga0466722_228933 3300042609 Bacteria 8341
15 Ga0466697_083590 3300042611 Bacteria 2197
16 Ga0466705_046601 3300042612 Bacteria 5769
17 Ga0466705_387301 3300042612 Unclassified 17093
18 Ga0466733_059268 3300042659 Bacteria 25661
19 Ga0466711_155160 3300042615 Bacteria 11303
20 Ga0466715_109224 3300042616 Bacteria 75833
21 Ga0466715_349362 3300042616 Bacteria 5872
22 Ga0466723_066623 3300042618 Unclassified 5143
23 Ga0466726_042905 3300042619 Bacteria 14115
24 Ga0466726_403927 3300042619 Bacteria 4174
25 Ga0466728_169008 3300042620 Bacteria 25778
26 Ga0466731_237977 3300042622 Bacteria 7293
27 Ga0466703_290124 3300042636 Bacteria 8320
28 Ga0466708_099406 3300042652 Bacteria 14004
29 Ga0466725_297904 3300042654 Bacteria 14838
30 Ga0466717_266981 3300042604 Bacteria 2128
31 Ga0466719_425727 3300042606 Bacteria 5941
32 Ga0466711_002552 3300042615 Unclassified 1169
33 Ga0466715_175784 3300042616 Bacteria 6488
34 Ga0466723_298572 3300042618 Bacteria 9528
35 Ga0466728_152411 3300042620 Bacteria 4546
36 Ga0466728_234738 3300042620 Bacteria 7792
37 Ga0466703_197495 3300042636 Bacteria 27336
38 Ga0466704_037147 3300042643 Unclassified 1171
39 Ga0466708_253802 3300042652 Bacteria 20440
40 Ga0466708_307162 3300042652 Bacteria 42833
41 Ga0466708_467274 3300042652 Bacteria 20579
42 Ga0466727_016314 3300042655 Bacteria 12921
43 Ga0466727_296297 3300042655 Bacteria 3624
44 Ga0466691_039935 3300042593 Bacteria 25425
45 Ga0466713_043321 3300042602 Bacteria 21588
46 Ga0466713_119544 3300042602 Unclassified 3639
47 Ga0466716_098196 3300042605 Bacteria 11814
48 Ga0466716_185707 3300042605 Unclassified 9282
49 Ga0466722_009947 3300042609 Bacteria 58351
50 2227546571 2225789004 Bacteria 2911
51 IMNBL1DRAFT_c0002120 3300000062 Bacteria 14126
52 Ga0466705_125588 3300042612 Bacteria 27996
53 Ga0466733_103492 3300042659 Bacteria 19163
54 Ga0466711_038761 3300042615 Bacteria 10433
55 Ga0466711_083363 3300042615 Bacteria 2233
56 Ga0466711_084189 3300042615 Bacteria 14152
57 Ga0466711_424279 3300042615 Bacteria 19107
58 Ga0466715_278824 3300042616 Bacteria 18319
59 Ga0466726_153120 3300042619 Unclassified 3864
60 Ga0466728_234478 3300042620 Bacteria 23263
61 Ga0466703_135301 3300042636 Bacteria 13728
62 Ga0466704_228618 3300042643 Bacteria 3689
63 Ga0466727_003774 3300042655 Bacteria 5542
64 Ga0466727_113211 3300042655 Bacteria 1786
65 Ga0466692_100322 3300042591 Bacteria 97018
66 Ga0466696_278334 3300042596 Bacteria 2039
67 Ga0466696_459997 3300042596 Bacteria 6563
68 Ga0466707_067819 3300042601 Bacteria 13397
69 Ga0466716_257364 3300042605 Bacteria 5972
70 Ga0466719_336229 3300042606 Unclassified 1459
71 JGI24702J35022_10002126 3300002462 Bacteria 12233
72 JGI24705J35276_12230949 3300002504 Bacteria 3781
73 Ga0068305_10043964 3300005083 Bacteria 7034
74 Ga0466705_400956 3300042612 Bacteria 24773
75 Ga0466711_287226 3300042615 Bacteria 2057
76 Ga0466723_254019 3300042618 Bacteria 22293
77 Ga0466729_158359 3300042621 Bacteria 24114
78 Ga0123354_10185626 3300010882 Bacteria 2354
79 Ga0466703_029931 3300042636 Bacteria 2898
80 Ga0466691_059224 3300042593 Bacteria 7239
81 Ga0466713_003458 3300042602 Bacteria 44331
82 Ga0466713_114043 3300042602 Bacteria 6718
83 Ga0466719_049009 3300042606 Unclassified 4568
84 2227519075 2225789004 Bacteria 17420
85 IMNBL1DRAFT_c0001903 3300000062 Bacteria 15106
86 Ga0466711_143457 3300042615 Bacteria 5135
87 Ga0466715_030319 3300042616 Bacteria 43703
88 Ga0466715_485052 3300042616 Bacteria 31199
89 Ga0466731_009211 3300042622 Bacteria 1271
90 Ga0466703_214731 3300042636 Bacteria 22711
91 Ga0466704_358678 3300042643 Unclassified 6236
92 Ga0466704_378891 3300042643 Bacteria 31782
93 Ga0466709_146820 3300042648 Bacteria 2179
94 Ga0466709_160051 3300042648 Bacteria 4641
95 Ga0466727_228012 3300042655 Bacteria 1989
96 Ga0466690_404125 3300042590 Bacteria 3136
97 Ga0466696_005035 3300042596 Bacteria 32427
98 Ga0466696_097978 3300042596 Bacteria 14664
99 Ga0466696_236668 3300042596 Bacteria 4954
100 Ga0466706_168047 3300042599 Bacteria 9503
101 Ga0466707_019140 3300042601 Unclassified 1654
102 Ga0466707_371795 3300042601 Bacteria 7931
103 Ga0466714_153181 3300042603 Bacteria 120481
104 JGI24702J35022_10018287 3300002462 Bacteria 3824
105 JGI24702J35022_10021861 3300002462 Bacteria 3466
106 Ga0068302_10222719 3300005071 Bacteria 2315
107 Ga0466711_175432 3300042615 Bacteria 3451
108 Ga0466711_254092 3300042615 Bacteria 3400
109 Ga0466718_033122 3300042617 Bacteria 1300
110 Ga0466728_106361 3300042620 Bacteria 7488
111 Ga0466728_230152 3300042620 Unclassified 6092
112 Ga0466703_208093 3300042636 Bacteria 6793
113 Ga0466690_431410 3300042590 Bacteria 3045
114 Ga0466691_175180 3300042593 Bacteria 5779
115 Ga0466696_487591 3300042596 Bacteria 13782
116 Ga0466707_018618 3300042601 Bacteria 7821
117 Ga0466716_109881 3300042605 Bacteria 5466
118 Ga0068302_10041588 3300005071 Bacteria 2064
119 Ga0068305_10038655 3300005083 Unclassified 3002
120 Ga0466705_401719 3300042612 Bacteria 3873
121 Ga0466705_496225 3300042612 Bacteria 1817
122 Ga0466703_170741 3300042636 Bacteria 15598
123 Ga0466703_322389 3300042636 Bacteria 2998
124 Ga0466727_156556 3300042655 Bacteria 4338
125 Ga0466692_055749 3300042591 Bacteria 10956
126 Ga0466696_068302 3300042596 Bacteria 6787
127 Ga0466701_045678 3300042598 Bacteria 7095
128 Ga0466706_268163 3300042599 Bacteria 17265
129 Ga0466713_063902 3300042602 Bacteria 5038
130 2227352990 2225789004 Bacteria 6165
131 IMNBL1DRAFT_c0009643 3300000062 Bacteria 4739
132 JGI24702J35022_10002906 3300002462 Bacteria 10370

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_153120 Ga0466726_153120_259_1155 291
2 3300042591 Ga0466692_100322 Ga0466692_100322_42710_43675 292
3 3300042655 Ga0466727_003774 Ga0466727_003774_2141_3073 292
4 3300000062 IMNBL1DRAFT_c0001903 IMNBL1DRAFT_00019034 293
5 3300042622 Ga0466731_009211 Ga0466731_009211_300_1181 293
6 3300000062 IMNBL1DRAFT_c0009643 IMNBL1DRAFT_00096434 295
7 3300042590 Ga0466690_409563 Ga0466690_409563_28804_29772 295
8 3300042598 Ga0466701_045678 Ga0466701_045678_1671_2582 295
9 3300042606 Ga0466719_049009 Ga0466719_049009_230_1117 295
10 3300042616 Ga0466715_030319 Ga0466715_030319_6781_7749 295
11 3300042618 Ga0466723_066623 Ga0466723_066623_2827_3792 295
12 3300042618 Ga0466723_080576 Ga0466723_080576_14226_15113 295
13 3300042620 Ga0466728_230152 Ga0466728_230152_5073_6041 295
14 3300042643 Ga0466704_037147 Ga0466704_037147_13_981 295
15 3300002462 JGI24702J35022_10021861 JGI24702J35022_100218612 296
16 3300042596 Ga0466696_005035 Ga0466696_005035_30993_31883 296
17 3300042596 Ga0466696_097978 Ga0466696_097978_12730_13695 296
18 3300042609 Ga0466722_009947 Ga0466722_009947_14335_15300 296
19 3300042612 Ga0466705_387301 Ga0466705_387301_9880_10770 296
20 3300042616 Ga0466715_301112 Ga0466715_301112_90_1082 296
21 3300042655 Ga0466727_113211 Ga0466727_113211_298_1260 298
22 3300042659 Ga0466733_059268 Ga0466733_059268_21938_22900 298
23 3300042616 Ga0466715_175784 Ga0466715_175784_2494_3504 299
24 3300042636 Ga0466703_214731 Ga0466703_214731_8565_9530 299
25 3300042601 Ga0466707_019140 Ga0466707_019140_194_1159 300
26 3300042636 Ga0466703_135301 Ga0466703_135301_393_1367 300
27 3300042601 Ga0466707_371795 Ga0466707_371795_366_1334 302
28 3300042620 Ga0466728_234738 Ga0466728_234738_817_1728 303
29 3300042636 Ga0466703_170741 Ga0466703_170741_3219_4184 304
30 3300042615 Ga0466711_143457 Ga0466711_143457_483_1448 305
31 3300042636 Ga0466703_290124 Ga0466703_290124_1316_2284 305
32 3300042596 Ga0466696_068302 Ga0466696_068302_5252_6217 306
33 3300042601 Ga0466707_067819 Ga0466707_067819_9464_10474 309
34 3300042605 Ga0466716_185707 Ga0466716_185707_3260_4222 309
35 3300042620 Ga0466728_169008 Ga0466728_169008_2428_3387 309
36 3300042618 Ga0466723_298572 Ga0466723_298572_544_1554 310
37 3300042648 Ga0466709_146820 Ga0466709_146820_195_1166 310
38 3300042655 Ga0466727_156556 Ga0466727_156556_843_1865 310
39 3300042601 Ga0466707_018618 Ga0466707_018618_6168_7130 311
40 3300005083 Ga0068305_10038655 Ga0068305_100386553 313
41 3300002504 JGI24705J35276_12230949 JGI24705J35276_122309492 314
42 3300010882 Ga0123354_10185626 Ga0123354_101856263 314
43 3300042604 Ga0466717_266981 Ga0466717_266981_808_1785 314
44 3300042619 Ga0466726_042905 Ga0466726_042905_12451_13398 315
45 3300042620 Ga0466728_152411 Ga0466728_152411_739_1716 315
46 3300042655 Ga0466727_016314 Ga0466727_016314_338_1285 315
47 3300042593 Ga0466691_059224 Ga0466691_059224_4421_5377 318
48 3300042603 Ga0466714_153181 Ga0466714_153181_106471_107427 318
49 3300042606 Ga0466719_425727 Ga0466719_425727_4017_4973 318
50 3300042612 Ga0466705_046601 Ga0466705_046601_3982_4938 318
51 3300042612 Ga0466705_400956 Ga0466705_400956_7875_8831 318
52 3300042612 Ga0466705_496225 Ga0466705_496225_399_1355 318
53 3300042620 Ga0466728_234478 Ga0466728_234478_748_1704 318
54 3300042643 Ga0466704_251609 Ga0466704_251609_38127_39083 318
55 3300042643 Ga0466704_358678 Ga0466704_358678_3640_4596 318
56 3300042643 Ga0466704_378891 Ga0466704_378891_11443_12399 318
57 2225789004 2227352990 2227798179 319
58 2225789004 2227546571 2228072509 319
59 3300002462 JGI24702J35022_10002126 JGI24702J35022_100021266 319
60 3300002462 JGI24702J35022_10002906 JGI24702J35022_100029065 319
61 3300002462 JGI24702J35022_10018287 JGI24702J35022_100182874 319
62 3300042593 Ga0466691_175180 Ga0466691_175180_2650_3609 319
63 3300042599 Ga0466706_168047 Ga0466706_168047_3846_4805 319
64 3300042599 Ga0466706_268163 Ga0466706_268163_11763_12722 319
65 3300042602 Ga0466713_043321 Ga0466713_043321_4379_5338 319
66 3300042605 Ga0466716_257364 Ga0466716_257364_3761_4720 319
67 3300042606 Ga0466719_336229 Ga0466719_336229_22_981 319
68 3300042611 Ga0466697_083590 Ga0466697_083590_1205_2164 319
69 3300042616 Ga0466715_109224 Ga0466715_109224_38570_39595 319
70 3300042616 Ga0466715_579190 Ga0466715_579190_586_1545 319
71 3300042652 Ga0466708_253802 Ga0466708_253802_16987_17946 319
72 3300042590 Ga0466690_404125 Ga0466690_404125_483_1445 320
73 3300042596 Ga0466696_459997 Ga0466696_459997_414_1433 320
74 3300042602 Ga0466713_003458 Ga0466713_003458_7736_8698 320
75 3300042605 Ga0466716_114211 Ga0466716_114211_28024_28986 320
76 3300042612 Ga0466705_401719 Ga0466705_401719_734_1696 320
77 3300042615 Ga0466711_084189 Ga0466711_084189_5645_6607 320
78 3300042615 Ga0466711_155160 Ga0466711_155160_10170_11132 320
79 3300042615 Ga0466711_434385 Ga0466711_434385_161_1123 320
80 3300042643 Ga0466704_228618 Ga0466704_228618_2228_3190 320
81 3300042659 Ga0466733_103492 Ga0466733_103492_1204_2235 320
82 2225789004 2227519075 2228020566 321
83 3300005071 Ga0068302_10041588 Ga0068302_100415882 321
84 3300005071 Ga0068302_10222719 Ga0068302_102227191 321
85 3300042617 Ga0466718_033122 Ga0466718_033122_251_1288 321
86 3300042618 Ga0466723_254019 Ga0466723_254019_7941_8906 321
87 3300042636 Ga0466703_029931 Ga0466703_029931_49_1014 321
88 3300042636 Ga0466703_322389 Ga0466703_322389_1704_2669 321
89 3300000062 IMNBL1DRAFT_c0002120 IMNBL1DRAFT_00021206 322
90 3300042609 Ga0466722_228933 Ga0466722_228933_2395_3363 322
91 3300042612 Ga0466705_125588 Ga0466705_125588_25108_26076 322
92 3300042621 Ga0466729_158359 Ga0466729_158359_2237_3205 322
93 iso_pr_bacteria 2940195863 2940198177 322
94 iso_pr_bacteria 2940205530 2940208017 322
95 iso_pr_bacteria 2940212447 2940215053 322
96 iso_pr_bacteria 2940298504 2940301107 322
97 iso_pr_bacteria 2940302308 2940304788 322
98 iso_pr_bacteria 2940306115 2940308490 322
99 iso_pr_bacteria 2940309933 2940312450 322
100 iso_pr_bacteria 2940313741 2940316262 322
101 iso_pr_bacteria 2940317558 2940320078 322
102 iso_pr_bacteria 2940321370 2940323833 322
103 iso_pr_bacteria 2940325180 2940327780 322
104 iso_pr_bacteria 2940328985 2940331464 322
105 iso_pr_bacteria 2940332795 2940335314 322
106 3300042596 Ga0466696_487591 Ga0466696_487591_11637_12617 326
107 3300042593 Ga0466691_039935 Ga0466691_039935_3720_4775 328
108 3300042652 Ga0466708_467274 Ga0466708_467274_8275_9297 328
109 3300042615 Ga0466711_287226 Ga0466711_287226_667_1656 329
110 3300042636 Ga0466703_208093 Ga0466703_208093_4417_5406 329
111 3300042602 Ga0466713_119544 Ga0466713_119544_2322_3335 331
112 3300042655 Ga0466727_296297 Ga0466727_296297_1979_2977 332
113 3300042605 Ga0466716_129240 Ga0466716_129240_9618_10664 333
114 3300042636 Ga0466703_197495 Ga0466703_197495_5915_6943 333
115 3300042619 Ga0466726_403927 Ga0466726_403927_239_1282 334
116 3300042652 Ga0466708_099406 Ga0466708_099406_12677_13681 334
117 3300042652 Ga0466708_307162 Ga0466708_307162_30294_31298 334
118 3300042616 Ga0466715_349362 Ga0466715_349362_3435_4442 335
119 3300042654 Ga0466725_297904 Ga0466725_297904_10931_11938 335
120 3300042596 Ga0466696_236668 Ga0466696_236668_1299_2309 336
121 3300042596 Ga0466696_278334 Ga0466696_278334_553_1563 336
122 3300042602 Ga0466713_114043 Ga0466713_114043_2115_3125 336
123 3300042615 Ga0466711_083363 Ga0466711_083363_676_1713 336
124 3300042622 Ga0466731_237977 Ga0466731_237977_2231_3241 336
125 3300042620 Ga0466728_106361 Ga0466728_106361_5289_6302 337
126 3300042654 Ga0466725_164174 Ga0466725_164174_1283_2296 337
127 3300042615 Ga0466711_002552 Ga0466711_002552_70_1116 338
128 3300042602 Ga0466713_063902 Ga0466713_063902_3450_4469 339
129 3300042605 Ga0466716_098196 Ga0466716_098196_7230_8249 339
130 3300042615 Ga0466711_038761 Ga0466711_038761_9287_10306 339
131 3300042655 Ga0466727_022134 Ga0466727_022134_8625_9644 339
132 3300005083 Ga0068305_10043964 Ga0068305_100439643 340
133 3300042612 Ga0466705_201614 Ga0466705_201614_154_1257 340
134 3300042615 Ga0466711_424279 Ga0466711_424279_8242_9288 341
135 3300042616 Ga0466715_278824 Ga0466715_278824_16459_17484 341
136 3300042618 Ga0466723_082277 Ga0466723_082277_8806_9834 342
137 3300042655 Ga0466727_228012 Ga0466727_228012_755_1786 343
138 3300042605 Ga0466716_109881 Ga0466716_109881_105_1169 346
139 3300042615 Ga0466711_175432 Ga0466711_175432_1957_3003 348
140 3300042615 Ga0466711_037934 Ga0466711_037934_248_1297 349
141 3300042615 Ga0466711_254092 Ga0466711_254092_734_1786 350
142 3300042590 Ga0466690_431410 Ga0466690_431410_310_1365 351
143 3300042648 Ga0466709_160051 Ga0466709_160051_3342_4436 351
144 3300042616 Ga0466715_485052 Ga0466715_485052_22450_23511 353
145 3300042591 Ga0466692_055749 Ga0466692_055749_6257_7348 363

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03462 PCRF PCRF domain 108 143 0.97
PF00472 RF-1 RF-1 domain 152 268 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03462 GO:0006415 translational termination BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.35 0.41 Low

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.