Protein Family IF07667

Metagenome Isolate
152 Members
47 Samples
145 Scaffolds
259.56 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_125292|Ga0466715_125292_2210_3001
Length
263 aa
Sequence
VANQSLKVVILAGGYGTRLSEETELRPKPMVEIGEKPILWHIMKIYSHYGFNEFVICCGYKSYYIKDYFYHYYMHTTDITLDLSANKITYHNSSSEPWKITLVDTGLKTMTGGRIKRIKEYIGNEPFMMTYGDGLSDINISQLLAHHQSSGKIATVTAVLPSGRFGAIKIGNNNEVISFFEKPRGDDSFINGGFFVLEPRVFDYIEGDSTIFEQQPLEKLAYEGQLQSFRHTGFWKPMDTLREKRELQELWNSGNPPWKVWHE

📊 Sample Types

Isolate 4.6%
Metagenome 95.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.1%
Kalotermitidae 22.2%
Unclassified 11.1%
Rhinotermitidae 4.4%
Elmidae 4.4%
Termopsidae 4.4%
Blattidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
21 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
26 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
27 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
47 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_228907 3300042612 Bacteria 3580
2 Ga0264413_134428 3300024493 Bacteria 2074
3 Ga0466694_130510 3300042594 Bacteria 4809
4 Ga0466699_397317 3300042597 Bacteria 8387
5 AustNasuHG_c1003838 3300000089 Bacteria 5411
6 JGI24698J34947_10002059 3300002449 Bacteria 10746
7 JGI24698J34947_10067777 3300002449 Unclassified 1730
8 JGI24702J35022_10008044 3300002462 Unclassified 6004
9 Ga0072941_1052615 3300005201 Bacteria 4329
10 Ga0074263_102645 3300005485 Bacteria 1964
11 Ga0466707_385621 3300042601 Bacteria 2430
12 Ga0466721_231996 3300042608 Bacteria 21619
13 Ga0466698_198241 3300042610 Bacteria 1698
14 Ga0466712_020759 3300042614 Bacteria 22637
15 Ga0466712_088268 3300042614 Bacteria 28448
16 Ga0466712_120902 3300042614 Bacteria 11264
17 Ga0466726_043101 3300042619 Bacteria 1424
18 Ga0123356_10489908 3300010049 Bacteria 1384
19 Ga0123356_10707068 3300010049 Bacteria 1177
20 Ga0466705_133982 3300042612 Bacteria 1272
21 Ga0264413_100365 3300024493 Bacteria 60695
22 Ga0264413_127955 3300024493 Bacteria 6578
23 JGI24698J34947_10009922 3300002449 Bacteria 5220
24 JGI24698J34947_10091337 3300002449 Bacteria 1396
25 Ga0072941_1019357 3300005201 Bacteria 12048
26 Ga0466720_117094 3300042607 Bacteria 9707
27 Ga0466720_128273 3300042607 Bacteria 13102
28 Ga0466720_131560 3300042607 Bacteria 48024
29 Ga0466720_178452 3300042607 Bacteria 61615
30 Ga0466698_132603 3300042610 Bacteria 1156
31 Ga0466712_069189 3300042614 Bacteria 44669
32 Ga0466715_125292 3300042616 Bacteria 16069
33 Ga0466718_023753 3300042617 Bacteria 2230
34 Ga0466718_024216 3300042617 Bacteria 2731
35 Ga0466723_042783 3300042618 Bacteria 9887
36 Ga0466727_278833 3300042655 Bacteria 1003
37 Ga0466690_165399 3300042590 Bacteria 10007
38 Ga0466690_213756 3300042590 Bacteria 2224
39 Ga0466694_330648 3300042594 Bacteria 1986
40 Ga0466699_267051 3300042597 Bacteria 1422
41 Ga0466699_347672 3300042597 Bacteria 12357
42 JGI24698J34947_10001938 3300002449 Bacteria 11023
43 JGI24698J34947_10003584 3300002449 Bacteria 8435
44 JGI24698J34947_10009443 3300002449 Bacteria 5354
45 Ga0068305_10076042 3300005083 Bacteria 17212
46 Ga0072941_1132065 3300005201 Bacteria 2796
47 Ga0466717_106801 3300042604 Bacteria 4370
48 Ga0466716_294197 3300042605 Bacteria 8694
49 Ga0466720_107599 3300042607 Unclassified 3053
50 Ga0466720_228795 3300042607 Bacteria 2312
51 Ga0466722_242751 3300042609 Unclassified 1487
52 Ga0466712_314281 3300042614 Bacteria 47963
53 Ga0466715_040160 3300042616 Bacteria 3796
54 Ga0466726_041633 3300042619 Bacteria 3323
55 Ga0466709_374247 3300042648 Bacteria 9528
56 Ga0466708_123773 3300042652 Bacteria 15379
57 Ga0466732_112176 3300042656 Bacteria 19030
58 Ga0264413_129880 3300024493 Bacteria 14819
59 Ga0466696_247226 3300042596 Bacteria 7154
60 AustNasuHG_c1005651 3300000089 Bacteria 4475
61 AustNasuHG_c1009386 3300000089 Bacteria 3434
62 JGI24698J34947_10000033 3300002449 Bacteria 37899
63 JGI24698J34947_10003060 3300002449 Bacteria 9058
64 Ga0072940_1044129 3300005200 Bacteria 1969
65 Ga0466720_037586 3300042607 Bacteria 39008
66 Ga0466722_252418 3300042609 Bacteria 17603
67 Ga0466712_036330 3300042614 Bacteria 18507
68 Ga0466712_154741 3300042614 Bacteria 1883
69 Ga0466718_013747 3300042617 Bacteria 2862
70 Ga0466726_079672 3300042619 Bacteria 1060
71 Ga0466726_098596 3300042619 Bacteria 2650
72 Ga0466726_101611 3300042619 Bacteria 9895
73 Ga0466708_236298 3300042652 Bacteria 4115
74 Ga0123357_10408897 3300009784 Bacteria 1225
75 Ga0264413_107964 3300024493 Bacteria 8300
76 Ga0264413_135090 3300024493 Bacteria 2973
77 Ga0415639_019877 3300038395 Bacteria 7071
78 Ga0466692_000561 3300042591 Bacteria 1612
79 Ga0466694_210483 3300042594 Bacteria 8464
80 Ga0466699_201316 3300042597 Bacteria 2508
81 AustNasuHG_c1001857 3300000089 Bacteria 7638
82 AustNasuHG_c1016113 3300000089 Bacteria 2507
83 JGI24698J34947_10019389 3300002449 Bacteria 3669
84 JGI24695J34938_10000444 3300002450 Bacteria 40024
85 Ga0466719_557293 3300042606 Bacteria 4787
86 Ga0466720_067609 3300042607 Bacteria 14979
87 Ga0466720_088947 3300042607 Bacteria 35866
88 Ga0466712_178122 3300042614 Bacteria 1768
89 Ga0466712_205055 3300042614 Bacteria 1494
90 Ga0466715_263798 3300042616 Bacteria 6465
91 Ga0466715_462602 3300042616 Bacteria 6765
92 Ga0466718_152439 3300042617 Bacteria 3715
93 Ga0466702_153670 3300042635 Bacteria 4995
94 Ga0466705_286764 3300042612 Bacteria 11434
95 Ga0466694_328281 3300042594 Bacteria 2020
96 Ga0466699_025879 3300042597 Bacteria 1262
97 AustNasuHG_c1007902 3300000089 Bacteria 3772
98 JGI24698J34947_10014969 3300002449 Bacteria 4224
99 JGI24698J34947_10015987 3300002449 Bacteria 4080
100 JGI24698J34947_10033488 3300002449 Bacteria 2695
101 JGI24698J34947_10078852 3300002449 Bacteria 1552
102 JGI24698J34947_10079667 3300002449 Bacteria 1541
103 JGI24702J35022_10000907 3300002462 Bacteria 18453
104 Ga0466722_212082 3300042609 Bacteria 3421
105 Ga0466712_229612 3300042614 Bacteria 10404
106 Ga0466711_220413 3300042615 Bacteria 5222
107 Ga0466731_255709 3300042622 Bacteria 5659
108 Ga0123357_10234473 3300009784 Archaea 2002
109 Ga0466695_396419 3300042595 Bacteria 1442
110 Ga0466699_033488 3300042597 Bacteria 1006
111 Ga0466699_064929 3300042597 Bacteria 24291
112 Ga0466699_102165 3300042597 Unclassified 19151
113 Ga0466699_157292 3300042597 Bacteria 2718
114 AustNasuHG_c1024110 3300000089 Bacteria 1933
115 JGI24698J34947_10005519 3300002449 Bacteria 6940
116 JGI24698J34947_10158382 3300002449 Bacteria 931
117 JGI24695J34938_10001462 3300002450 Bacteria 19978
118 Ga0068305_10013170 3300005083 Bacteria 17816
119 Ga0466720_046917 3300042607 Bacteria 61630
120 Ga0466720_065410 3300042607 Bacteria 38105
121 Ga0466722_109307 3300042609 Bacteria 12144
122 Ga0466712_282502 3300042614 Bacteria 3537
123 Ga0466726_275000 3300042619 Bacteria 1285
124 Ga0466731_048131 3300042622 Bacteria 17747
125 Ga0123356_10000062 3300010049 Bacteria 112695
126 Ga0123353_10543141 3300010167 Unclassified 1679
127 Ga0466732_405751 3300042656 Bacteria 1456
128 Ga0264413_105469 3300024493 Bacteria 17630
129 Ga0466690_096688 3300042590 Bacteria 2560
130 Ga0466692_143992 3300042591 Bacteria 18534
131 Ga0466699_329206 3300042597 Bacteria 1106
132 AustNasuHG_c1013614 3300000089 Bacteria 2786
133 JGI24698J34947_10000332 3300002449 Bacteria 20875
134 JGI24698J34947_10000470 3300002449 Bacteria 18822
135 JGI24698J34947_10131754 3300002449 Bacteria 1067
136 JGI24695J34938_10000154 3300002450 Bacteria 63067
137 JGI24696J40584_12961154 3300002834 Bacteria 11386
138 Ga0072941_1036677 3300005201 Bacteria 3483
139 Ga0466712_068745 3300042614 Bacteria 20233
140 Ga0466712_155758 3300042614 Bacteria 3536
141 Ga0466718_122285 3300042617 Bacteria 4854
142 Ga0466726_432311 3300042619 Bacteria 6491
143 Ga0466726_472131 3300042619 Bacteria 10957
144 Ga0466727_304033 3300042655 Bacteria 2536
145 Ga0123353_10161412 3300010167 Bacteria 3568

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002449 JGI24698J34947_10002059 JGI24698J34947_100020596 232
2 3300042590 Ga0466690_096688 Ga0466690_096688_13_720 235
3 3300000089 AustNasuHG_c1024110 AustNasuHG_10241102 236
4 3300042619 Ga0466726_043101 Ga0466726_043101_25_738 237
5 3300042619 Ga0466726_079672 Ga0466726_079672_84_800 238
6 3300024493 Ga0264413_129880 Ga0264413_1298807 254
7 3300042652 Ga0466708_123773 Ga0466708_123773_11395_12162 255
8 3300042596 Ga0466696_247226 Ga0466696_247226_1535_2308 257
9 3300042597 Ga0466699_201316 Ga0466699_201316_1190_1963 257
10 3300042601 Ga0466707_385621 Ga0466707_385621_492_1265 257
11 3300042605 Ga0466716_294197 Ga0466716_294197_4638_5411 257
12 3300042619 Ga0466726_098596 Ga0466726_098596_512_1285 257
13 3300042619 Ga0466726_275000 Ga0466726_275000_319_1092 257
14 3300042655 Ga0466727_278833 Ga0466727_278833_172_945 257
15 iso_pr_bacteria 2864870719 2864871045 257
16 iso_pr_bacteria 2864960361 2864960689 257
17 iso_pr_bacteria 2940373808 2940373998 257
18 iso_pr_bacteria 2940373808 2940374724 257
19 3300042606 Ga0466719_557293 Ga0466719_557293_2405_3181 258
20 3300042607 Ga0466720_228795 Ga0466720_228795_243_1019 258
21 3300042609 Ga0466722_109307 Ga0466722_109307_7799_8575 258
22 3300042612 Ga0466705_228907 Ga0466705_228907_2220_2996 258
23 3300042612 Ga0466705_286764 Ga0466705_286764_7201_7977 258
24 3300042616 Ga0466715_263798 Ga0466715_263798_1620_2396 258
25 3300002834 JGI24696J40584_12961154 JGI24696J40584_129611543 259
26 3300024493 Ga0264413_100365 Ga0264413_10036539 259
27 3300024493 Ga0264413_105469 Ga0264413_1054692 259
28 3300024493 Ga0264413_107964 Ga0264413_1079643 259
29 3300024493 Ga0264413_127955 Ga0264413_1279557 259
30 3300024493 Ga0264413_134428 Ga0264413_1344282 259
31 3300024493 Ga0264413_135090 Ga0264413_1350902 259
32 3300038395 Ga0415639_019877 Ga0415639_019877_2333_3112 259
33 3300042590 Ga0466690_213756 Ga0466690_213756_663_1442 259
34 3300042591 Ga0466692_000561 Ga0466692_000561_54_833 259
35 3300042591 Ga0466692_143992 Ga0466692_143992_180_959 259
36 3300042594 Ga0466694_130510 Ga0466694_130510_1623_2402 259
37 3300042594 Ga0466694_210483 Ga0466694_210483_460_1239 259
38 3300042594 Ga0466694_328281 Ga0466694_328281_765_1544 259
39 3300042594 Ga0466694_330648 Ga0466694_330648_894_1673 259
40 3300042597 Ga0466699_025879 Ga0466699_025879_26_805 259
41 3300042597 Ga0466699_033488 Ga0466699_033488_78_857 259
42 3300042597 Ga0466699_064929 Ga0466699_064929_21861_22640 259
43 3300042597 Ga0466699_102165 Ga0466699_102165_10487_11266 259
44 3300042597 Ga0466699_329206 Ga0466699_329206_93_872 259
45 3300042597 Ga0466699_347672 Ga0466699_347672_4569_5348 259
46 3300042597 Ga0466699_397317 Ga0466699_397317_5681_6460 259
47 3300042607 Ga0466720_037586 Ga0466720_037586_26505_27284 259
48 3300042607 Ga0466720_046917 Ga0466720_046917_24042_24821 259
49 3300042607 Ga0466720_065410 Ga0466720_065410_28447_29226 259
50 3300042607 Ga0466720_067609 Ga0466720_067609_8126_8905 259
51 3300042607 Ga0466720_088947 Ga0466720_088947_29186_29965 259
52 3300042607 Ga0466720_107599 Ga0466720_107599_1523_2302 259
53 3300042607 Ga0466720_117094 Ga0466720_117094_2656_3435 259
54 3300042607 Ga0466720_128273 Ga0466720_128273_3568_4347 259
55 3300042607 Ga0466720_131560 Ga0466720_131560_2184_2963 259
56 3300042607 Ga0466720_178452 Ga0466720_178452_19436_20215 259
57 3300042608 Ga0466721_231996 Ga0466721_231996_512_1291 259
58 3300042609 Ga0466722_212082 Ga0466722_212082_1643_2422 259
59 3300042609 Ga0466722_242751 Ga0466722_242751_370_1149 259
60 3300042610 Ga0466698_132603 Ga0466698_132603_188_967 259
61 3300042610 Ga0466698_198241 Ga0466698_198241_820_1599 259
62 3300042612 Ga0466705_133982 Ga0466705_133982_36_815 259
63 3300042614 Ga0466712_020759 Ga0466712_020759_14536_15315 259
64 3300042614 Ga0466712_088268 Ga0466712_088268_5913_6692 259
65 3300042614 Ga0466712_120902 Ga0466712_120902_101_880 259
66 3300042614 Ga0466712_154741 Ga0466712_154741_1052_1831 259
67 3300042614 Ga0466712_155758 Ga0466712_155758_221_1000 259
68 3300042614 Ga0466712_205055 Ga0466712_205055_463_1242 259
69 3300042614 Ga0466712_229612 Ga0466712_229612_5212_5991 259
70 3300042614 Ga0466712_282502 Ga0466712_282502_281_1060 259
71 3300042614 Ga0466712_314281 Ga0466712_314281_30619_31398 259
72 3300042615 Ga0466711_220413 Ga0466711_220413_2988_3767 259
73 3300042616 Ga0466715_462602 Ga0466715_462602_5046_5825 259
74 3300042617 Ga0466718_013747 Ga0466718_013747_24_803 259
75 3300042617 Ga0466718_023753 Ga0466718_023753_508_1287 259
76 3300042617 Ga0466718_024216 Ga0466718_024216_764_1543 259
77 3300042617 Ga0466718_122285 Ga0466718_122285_391_1170 259
78 3300042617 Ga0466718_152439 Ga0466718_152439_24_803 259
79 3300042622 Ga0466731_255709 Ga0466731_255709_308_1087 259
80 3300042648 Ga0466709_374247 Ga0466709_374247_8196_8975 259
81 3300042652 Ga0466708_236298 Ga0466708_236298_2761_3540 259
82 3300042656 Ga0466732_405751 Ga0466732_405751_556_1335 259
83 iso_pr_bacteria 2773857779 2774477698 259
84 iso_pr_bacteria 2820027804 2820028497 259
85 3300000089 AustNasuHG_c1001857 AustNasuHG_100185711 260
86 3300000089 AustNasuHG_c1003838 AustNasuHG_10038382 260
87 3300000089 AustNasuHG_c1005651 AustNasuHG_10056512 260
88 3300000089 AustNasuHG_c1007902 AustNasuHG_10079023 260
89 3300000089 AustNasuHG_c1009386 AustNasuHG_10093862 260
90 3300000089 AustNasuHG_c1013614 AustNasuHG_10136143 260
91 3300000089 AustNasuHG_c1016113 AustNasuHG_10161132 260
92 3300002449 JGI24698J34947_10000033 JGI24698J34947_1000003334 260
93 3300002449 JGI24698J34947_10000332 JGI24698J34947_1000033218 260
94 3300002449 JGI24698J34947_10000470 JGI24698J34947_1000047013 260
95 3300002449 JGI24698J34947_10001938 JGI24698J34947_100019388 260
96 3300002449 JGI24698J34947_10003060 JGI24698J34947_100030603 260
97 3300002449 JGI24698J34947_10003584 JGI24698J34947_100035843 260
98 3300002449 JGI24698J34947_10005519 JGI24698J34947_100055197 260
99 3300002449 JGI24698J34947_10009443 JGI24698J34947_100094433 260
100 3300002449 JGI24698J34947_10009922 JGI24698J34947_100099224 260
101 3300002449 JGI24698J34947_10014969 JGI24698J34947_100149693 260
102 3300002449 JGI24698J34947_10019389 JGI24698J34947_100193892 260
103 3300002449 JGI24698J34947_10033488 JGI24698J34947_100334881 260
104 3300002449 JGI24698J34947_10067777 JGI24698J34947_100677771 260
105 3300002449 JGI24698J34947_10078852 JGI24698J34947_100788521 260
106 3300002449 JGI24698J34947_10079667 JGI24698J34947_100796671 260
107 3300002449 JGI24698J34947_10091337 JGI24698J34947_100913372 260
108 3300002449 JGI24698J34947_10131754 JGI24698J34947_101317541 260
109 3300002449 JGI24698J34947_10158382 JGI24698J34947_101583821 260
110 3300002450 JGI24695J34938_10000154 JGI24695J34938_1000015454 260
111 3300002450 JGI24695J34938_10000444 JGI24695J34938_1000044428 260
112 3300002450 JGI24695J34938_10001462 JGI24695J34938_1000146220 260
113 3300002462 JGI24702J35022_10000907 JGI24702J35022_100009072 260
114 3300005200 Ga0072940_1044129 Ga0072940_10441292 260
115 3300005201 Ga0072941_1019357 Ga0072941_101935712 260
116 3300005201 Ga0072941_1132065 Ga0072941_11320653 260
117 3300005485 Ga0074263_102645 Ga0074263_1026452 260
118 3300009784 Ga0123357_10408897 Ga0123357_104088972 260
119 3300042597 Ga0466699_157292 Ga0466699_157292_69_851 260
120 3300042614 Ga0466712_068745 Ga0466712_068745_10855_11637 260
121 3300042618 Ga0466723_042783 Ga0466723_042783_2590_3372 260
122 3300005083 Ga0068305_10013170 Ga0068305_100131707 261
123 3300010167 Ga0123353_10543141 Ga0123353_105431412 261
124 3300042595 Ga0466695_396419 Ga0466695_396419_621_1406 261
125 3300042614 Ga0466712_036330 Ga0466712_036330_15264_16049 261
126 iso_pr_bacteria 2781125660 2781330235 261
127 3300002462 JGI24702J35022_10008044 JGI24702J35022_100080444 262
128 3300010049 Ga0123356_10000062 Ga0123356_1000006228 262
129 3300010167 Ga0123353_10161412 Ga0123353_101614123 262
130 3300042614 Ga0466712_069189 Ga0466712_069189_30159_30947 262
131 3300042614 Ga0466712_178122 Ga0466712_178122_716_1504 262
132 3300042619 Ga0466726_041633 Ga0466726_041633_2255_3043 262
133 3300042619 Ga0466726_101611 Ga0466726_101611_4299_5087 262
134 3300002449 JGI24698J34947_10015987 JGI24698J34947_100159872 263
135 3300005201 Ga0072941_1036677 Ga0072941_10366773 263
136 3300005201 Ga0072941_1052615 Ga0072941_10526152 263
137 3300010049 Ga0123356_10707068 Ga0123356_107070682 263
138 3300042609 Ga0466722_252418 Ga0466722_252418_14105_14896 263
139 3300042616 Ga0466715_125292 Ga0466715_125292_2210_3001 263
140 3300042619 Ga0466726_432311 Ga0466726_432311_1559_2350 263
141 3300042655 Ga0466727_304033 Ga0466727_304033_194_985 263
142 3300005083 Ga0068305_10076042 Ga0068305_1007604218 264
143 3300009784 Ga0123357_10234473 Ga0123357_102344732 265
144 3300042622 Ga0466731_048131 Ga0466731_048131_9675_10472 265
145 3300042656 Ga0466732_112176 Ga0466732_112176_10026_10826 266
146 3300010049 Ga0123356_10489908 Ga0123356_104899082 269
147 3300042635 Ga0466702_153670 Ga0466702_153670_2250_3068 272
148 3300042616 Ga0466715_040160 Ga0466715_040160_1774_2595 273
149 3300042619 Ga0466726_472131 Ga0466726_472131_7483_8304 273
150 3300042590 Ga0466690_165399 Ga0466690_165399_7872_8696 274
151 3300042604 Ga0466717_106801 Ga0466717_106801_2705_3538 277
152 3300042597 Ga0466699_267051 Ga0466699_267051_212_1084 290

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12804 NTP_transf_3 MobA-like NTP transferase domain 8 65 0.85
PF00483 NTP_transferase Nucleotidyl transferase 7 206 0.85

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00483 GO:0009058 biosynthetic process BP

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
1tzf-assembly1.cif.gz_A X-ray Crystal Structure of alpha-D-glucose-1-phosphate cytidylyltransferase from Salmonella typhi 0.93 4 262
1wvc-assembly1.cif.gz_A alpha-D-glucose-1-phosphate cytidylyltransferase complexed with CTP 0.913 6 262
4y7t-assembly1.cif.gz_A Structural analysis of MurU 0.814 6 254
4y7v-assembly1.cif.gz_A Structural analysis of MurU 0.808 6 252
8hhd-assembly1.cif.gz_B Crystal structure of PaMurU 0.807 6 251
IDDescriptionScoreStartEndSuperfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9296 4 262 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8529 99 238 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8079 6 252 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7869 2 254 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7743 6 254 3.90.550.10
IDDescriptionScoreStartEndGO Terms
AF-A0A015Z9D3-F1-model_v4 Uncharacterized/unreviewed 0.9816 30 259 GO:0047343
GO:0009243
AF-A0A5E8KFH9-F1-model_v4 Uncharacterized/unreviewed 0.977 115 261

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.