Protein Family IF07640

Metagenome Isolate
116 Members
37 Samples
111 Scaffolds
285.1 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_075770|Ga0466715_075770_3212_4126
Length
304 aa
Sequence
VFDYHSFAPLAAAAEEAGTPVSVIVLADQARQMERSEGELFDEMRKTLEVMKAAAAGGADPLLRSPSGLSGGLSFRMKERLGKKTLSGPFCTAAIARALAVAEYNAAMGRIVAAPTAGACGILPAAVLTMLEGDLRTGGAAHTGGRPRRVTEAAAVMSLFTAGALGMVIANEACIAGAEGGCQAECGSASAMAAAALAELAGGGPAMVSHAAAIALKNQLGLVCDPVAGLVEVPCVKRNAGGIMCAIGAAEMALAGIESVIPLDEVITAMGEIGAALPATLRETAQGGLAATPTGLEIRRKIFG

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.1%
Unclassified 21.6%
Termitidae 21.6%
Termopsidae 10.8%
Rhinotermitidae 8.1%
Hodotermitidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
2 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
3 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
4 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
28 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_109406 3300042616 Bacteria 5322
2 Ga0466715_147716 3300042616 Bacteria 1834
3 Ga0466715_335413 3300042616 Bacteria 11583
4 Ga0466723_181101 3300042618 Bacteria 3501
5 Ga0466723_229569 3300042618 Bacteria 135891
6 Ga0466728_235396 3300042620 Bacteria 3411
7 Ga0123355_10159510 3300009826 Bacteria 3402
8 Ga0123353_10010360 3300010167 Unclassified 12986
9 Ga0466729_200026 3300042621 Bacteria 1390
10 Ga0466706_106526 3300042599 Bacteria 2190
11 Ga0466707_275338 3300042601 Bacteria 1458
12 Ga0466716_466075 3300042605 Bacteria 2805
13 Ga0466719_147793 3300042606 Bacteria 5249
14 Ga0466722_176094 3300042609 Bacteria 2273
15 Ga0068305_10492575 3300005083 Bacteria 12577
16 Ga0466715_115540 3300042616 Unclassified 6994
17 Ga0466723_011294 3300042618 Bacteria 53611
18 Ga0466723_126518 3300042618 Bacteria 19136
19 Ga0466726_142265 3300042619 Bacteria 2114
20 Ga0123355_10872296 3300009826 Unclassified 985
21 Ga0123353_10305952 3300010167 Bacteria 2423
22 Ga0466704_077907 3300042643 Bacteria 5345
23 Ga0466704_248982 3300042643 Bacteria 16931
24 Ga0466709_204731 3300042648 Unclassified 6282
25 Ga0466691_072630 3300042593 Bacteria 2222
26 Ga0466707_239058 3300042601 Bacteria 1424
27 Ga0466707_251806 3300042601 Bacteria 3507
28 Ga0466713_148447 3300042602 Bacteria 1367
29 Ga0466722_109062 3300042609 Bacteria 4766
30 Ga0466705_116516 3300042612 Bacteria 11566
31 Ga0466723_290981 3300042618 Bacteria 2442
32 Ga0466726_196816 3300042619 Bacteria 2409
33 Ga0466728_060943 3300042620 Bacteria 5863
34 Ga0123357_10135961 3300009784 Unclassified 3040
35 Ga0123355_10000701 3300009826 Bacteria 45410
36 Ga0123355_10002508 3300009826 Bacteria 26011
37 Ga0123355_10019724 3300009826 Bacteria 10741
38 Ga0123353_10457361 3300010167 Unclassified 1877
39 Ga0466704_056398 3300042643 Bacteria 4368
40 Ga0466708_025332 3300042652 Bacteria 7999
41 Ga0466708_253656 3300042652 Bacteria 9770
42 Ga0415639_235278 3300038395 Bacteria 1486
43 Ga0466691_157688 3300042593 Bacteria 28759
44 Ga0466707_328189 3300042601 Bacteria 2205
45 Ga0068302_10113268 3300005071 Bacteria 1115
46 Ga0466705_202204 3300042612 Bacteria 7247
47 Ga0466727_348875 3300042655 Bacteria 3113
48 Ga0466715_046098 3300042616 Bacteria 3770
49 Ga0466715_559163 3300042616 Bacteria 16833
50 Ga0466723_113916 3300042618 Bacteria 12126
51 Ga0466723_132121 3300042618 Bacteria 12404
52 Ga0466726_055393 3300042619 Bacteria 4849
53 Ga0123356_10220943 3300010049 Bacteria 1951
54 Ga0123353_10028069 3300010167 Unclassified 8638
55 Ga0466704_316404 3300042643 Bacteria 34298
56 Ga0466692_055033 3300042591 Bacteria 24817
57 Ga0466713_124478 3300042602 Unclassified 1791
58 Ga0466719_488275 3300042606 Bacteria 1938
59 Ga0466719_575710 3300042606 Bacteria 8976
60 Ga0466722_080291 3300042609 Bacteria 6974
61 Ga0466722_085260 3300042609 Bacteria 7573
62 Ga0466722_094121 3300042609 Bacteria 4560
63 Ga0466723_087757 3300042618 Bacteria 22109
64 Ga0466723_150383 3300042618 Bacteria 7727
65 Ga0466723_162448 3300042618 Bacteria 2026
66 Ga0466723_322064 3300042618 Bacteria 1794
67 Ga0123355_10006901 3300009826 Bacteria 16906
68 Ga0123355_10447117 3300009826 Bacteria 1632
69 Ga0466731_328038 3300042622 Bacteria 2793
70 Ga0466735_151174 3300042624 Bacteria 11305
71 Ga0466703_145657 3300042636 Bacteria 1491
72 Ga0466703_256991 3300042636 Bacteria 11991
73 Ga0466703_316315 3300042636 Bacteria 6411
74 Ga0466690_155072 3300042590 Bacteria 9522
75 Ga0466690_197629 3300042590 Bacteria 4780
76 Ga0466693_238631 3300042592 Bacteria 5736
77 Ga0466691_011351 3300042593 Bacteria 9209
78 Ga0466733_189155 3300042659 Bacteria 2473
79 Ga0466715_075770 3300042616 Bacteria 4312
80 Ga0123353_10854003 3300010167 Bacteria 1247
81 Ga0466703_068799 3300042636 Bacteria 28085
82 Ga0466708_044211 3300042652 Bacteria 16621
83 Ga0466727_174254 3300042655 Bacteria 3387
84 Ga0466691_021275 3300042593 Bacteria 5943
85 Ga0466696_007169 3300042596 Bacteria 6718
86 Ga0466696_129745 3300042596 Bacteria 25058
87 Ga0466719_015336 3300042606 Bacteria 1736
88 Ga0466719_420983 3300042606 Unclassified 2676
89 Ga0466722_068235 3300042609 Bacteria 14587
90 Ga0466705_099197 3300042612 Bacteria 8370
91 Ga0466715_123280 3300042616 Bacteria 4492
92 Ga0466726_223271 3300042619 Bacteria 1308
93 Ga0466726_333610 3300042619 Bacteria 2662
94 Ga0466728_207263 3300042620 Bacteria 13163
95 Ga0123355_10050863 3300009826 Bacteria 6728
96 Ga0123353_10291555 3300010167 Bacteria 2497
97 Ga0466703_360992 3300042636 Bacteria 10288
98 Ga0466690_102116 3300042590 Bacteria 3470
99 Ga0466707_016956 3300042601 Bacteria 10709
100 Ga0466707_382762 3300042601 Bacteria 2321
101 Ga0466715_272365 3300042616 Bacteria 50899
102 Ga0466715_487341 3300042616 Bacteria 37758
103 Ga0466726_096078 3300042619 Bacteria 6367
104 Ga0466726_473578 3300042619 Unclassified 2309
105 Ga0466729_254550 3300042621 Bacteria 3043
106 Ga0466691_207329 3300042593 Bacteria 5395
107 Ga0466706_186077 3300042599 Bacteria 1601
108 Ga0466707_159901 3300042601 Bacteria 20133
109 Ga0466716_055868 3300042605 Bacteria 1480
110 Ga0466722_015744 3300042609 Bacteria 13213
111 Ga0466722_186510 3300042609 Bacteria 3475

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_275338 Ga0466707_275338_421_1305 247
2 3300042636 Ga0466703_145657 Ga0466703_145657_35_889 252
3 3300009826 Ga0123355_10002508 Ga0123355_1000250813 253
4 3300042621 Ga0466729_254550 Ga0466729_254550_255_1142 255
5 3300042618 Ga0466723_126518 Ga0466723_126518_6479_7345 257
6 3300009826 Ga0123355_10050863 Ga0123355_100508635 259
7 3300042618 Ga0466723_229569 Ga0466723_229569_119488_120360 261
8 3300042591 Ga0466692_055033 Ga0466692_055033_6540_7415 262
9 3300042599 Ga0466706_186077 Ga0466706_186077_680_1555 264
10 3300042618 Ga0466723_290981 Ga0466723_290981_1381_2256 265
11 3300042609 Ga0466722_094121 Ga0466722_094121_1746_2630 267
12 3300042616 Ga0466715_487341 Ga0466715_487341_33009_33881 267
13 3300042636 Ga0466703_068799 Ga0466703_068799_22452_23324 267
14 3300042609 Ga0466722_085260 Ga0466722_085260_3707_4606 268
15 3300042609 Ga0466722_015744 Ga0466722_015744_7548_8426 270
16 3300042622 Ga0466731_328038 Ga0466731_328038_1670_2482 270
17 3300042619 Ga0466726_333610 Ga0466726_333610_1119_2012 271
18 3300042601 Ga0466707_159901 Ga0466707_159901_18230_19084 272
19 3300042601 Ga0466707_251806 Ga0466707_251806_80_964 272
20 3300042624 Ga0466735_151174 Ga0466735_151174_312_1181 272
21 3300042648 Ga0466709_204731 Ga0466709_204731_4876_5748 272
22 3300042601 Ga0466707_239058 Ga0466707_239058_478_1350 273
23 3300042618 Ga0466723_162448 Ga0466723_162448_370_1239 273
24 3300042621 Ga0466729_200026 Ga0466729_200026_459_1346 273
25 3300009784 Ga0123357_10135961 Ga0123357_101359612 274
26 3300042593 Ga0466691_157688 Ga0466691_157688_1796_2668 275
27 3300042659 Ga0466733_189155 Ga0466733_189155_228_1109 276
28 3300009826 Ga0123355_10872296 Ga0123355_108722962 277
29 3300009826 Ga0123355_10006901 Ga0123355_100069019 278
30 3300042599 Ga0466706_106526 Ga0466706_106526_853_1743 278
31 3300042612 Ga0466705_202204 Ga0466705_202204_2120_2974 278
32 3300010167 Ga0123353_10010360 Ga0123353_100103609 280
33 3300042596 Ga0466696_007169 Ga0466696_007169_576_1448 280
34 3300042616 Ga0466715_115540 Ga0466715_115540_755_1627 280
35 3300042592 Ga0466693_238631 Ga0466693_238631_960_1832 281
36 3300009826 Ga0123355_10000701 Ga0123355_100007013 282
37 3300009826 Ga0123355_10159510 Ga0123355_101595102 282
38 3300042643 Ga0466704_316404 Ga0466704_316404_10211_11083 283
39 3300042609 Ga0466722_080291 Ga0466722_080291_2048_2926 284
40 iso_pr_bacteria 2820906387 2820907586 284
41 3300042593 Ga0466691_072630 Ga0466691_072630_1105_1986 285
42 3300042616 Ga0466715_335413 Ga0466715_335413_1062_2006 285
43 3300042590 Ga0466690_155072 Ga0466690_155072_3836_4711 286
44 3300042619 Ga0466726_473578 Ga0466726_473578_969_1847 286
45 3300042605 Ga0466716_055868 Ga0466716_055868_419_1300 287
46 3300042616 Ga0466715_559163 Ga0466715_559163_2493_3428 287
47 3300042619 Ga0466726_223271 Ga0466726_223271_17_883 288
48 3300042652 Ga0466708_025332 Ga0466708_025332_5998_6864 288
49 3300042590 Ga0466690_197629 Ga0466690_197629_3842_4714 290
50 3300042596 Ga0466696_129745 Ga0466696_129745_19308_20180 290
51 3300042602 Ga0466713_148447 Ga0466713_148447_160_1032 290
52 3300042605 Ga0466716_466075 Ga0466716_466075_258_1130 290
53 3300042606 Ga0466719_015336 Ga0466719_015336_15_887 290
54 3300042606 Ga0466719_147793 Ga0466719_147793_4180_5052 290
55 3300042609 Ga0466722_068235 Ga0466722_068235_223_1095 290
56 3300042609 Ga0466722_186510 Ga0466722_186510_231_1103 290
57 3300042616 Ga0466715_046098 Ga0466715_046098_1051_1923 290
58 3300042616 Ga0466715_109406 Ga0466715_109406_156_1028 290
59 3300042616 Ga0466715_123280 Ga0466715_123280_1839_2711 290
60 3300042616 Ga0466715_147716 Ga0466715_147716_886_1758 290
61 3300042616 Ga0466715_272365 Ga0466715_272365_41303_42175 290
62 3300042618 Ga0466723_132121 Ga0466723_132121_6076_6948 290
63 3300042618 Ga0466723_150383 Ga0466723_150383_81_953 290
64 3300042618 Ga0466723_181101 Ga0466723_181101_544_1416 290
65 3300042619 Ga0466726_196816 Ga0466726_196816_914_1786 290
66 3300042620 Ga0466728_060943 Ga0466728_060943_3731_4603 290
67 3300042620 Ga0466728_207263 Ga0466728_207263_1400_2272 290
68 3300042636 Ga0466703_316315 Ga0466703_316315_3206_4078 290
69 3300042636 Ga0466703_360992 Ga0466703_360992_8760_9632 290
70 3300042643 Ga0466704_056398 Ga0466704_056398_1597_2469 290
71 3300042643 Ga0466704_248982 Ga0466704_248982_7439_8311 290
72 3300042652 Ga0466708_253656 Ga0466708_253656_2024_2896 290
73 3300042593 Ga0466691_021275 Ga0466691_021275_1905_2780 291
74 3300042606 Ga0466719_488275 Ga0466719_488275_388_1263 291
75 3300042618 Ga0466723_011294 Ga0466723_011294_24090_24965 291
76 3300042636 Ga0466703_256991 Ga0466703_256991_4610_5485 291
77 3300042643 Ga0466704_077907 Ga0466704_077907_2395_3270 291
78 iso_pr_bacteria 2820472365 2820474113 291
79 iso_pr_bacteria 2820856540 2820857168 291
80 3300038395 Ga0415639_235278 Ga0415639_235278_81_959 292
81 3300042606 Ga0466719_420983 Ga0466719_420983_1613_2491 292
82 3300042619 Ga0466726_142265 Ga0466726_142265_310_1188 292
83 iso_pr_bacteria 2820027804 2820028246 292
84 iso_pr_bacteria 2820356982 2820357788 292
85 3300005071 Ga0068302_10113268 Ga0068302_101132682 293
86 3300010167 Ga0123353_10291555 Ga0123353_102915553 293
87 3300010167 Ga0123353_10457361 Ga0123353_104573612 293
88 3300042609 Ga0466722_109062 Ga0466722_109062_1911_2792 293
89 3300010049 Ga0123356_10220943 Ga0123356_102209432 294
90 3300042601 Ga0466707_016956 Ga0466707_016956_5075_5959 294
91 3300042601 Ga0466707_382762 Ga0466707_382762_1016_1900 294
92 3300042612 Ga0466705_116516 Ga0466705_116516_1060_1944 294
93 3300042618 Ga0466723_087757 Ga0466723_087757_4004_4888 294
94 3300042618 Ga0466723_113916 Ga0466723_113916_8320_9204 294
95 3300042618 Ga0466723_322064 Ga0466723_322064_754_1638 294
96 3300009826 Ga0123355_10447117 Ga0123355_104471173 295
97 3300010167 Ga0123353_10028069 Ga0123353_100280693 295
98 3300010167 Ga0123353_10854003 Ga0123353_108540031 295
99 3300042590 Ga0466690_102116 Ga0466690_102116_1520_2407 295
100 3300042593 Ga0466691_011351 Ga0466691_011351_5060_5947 295
101 3300042620 Ga0466728_235396 Ga0466728_235396_1676_2563 295
102 3300010167 Ga0123353_10305952 Ga0123353_103059522 296
103 3300042593 Ga0466691_207329 Ga0466691_207329_3143_4033 296
104 3300042601 Ga0466707_328189 Ga0466707_328189_395_1288 297
105 3300042652 Ga0466708_044211 Ga0466708_044211_5458_6351 297
106 3300042606 Ga0466719_575710 Ga0466719_575710_3239_4156 298
107 3300042655 Ga0466727_174254 Ga0466727_174254_2079_2975 298
108 3300042655 Ga0466727_348875 Ga0466727_348875_895_1791 298
109 3300042602 Ga0466713_124478 Ga0466713_124478_431_1330 299
110 3300042619 Ga0466726_096078 Ga0466726_096078_884_1783 299
111 3300005083 Ga0068305_10492575 Ga0068305_1049257510 300
112 3300009826 Ga0123355_10019724 Ga0123355_100197248 300
113 3300042609 Ga0466722_176094 Ga0466722_176094_523_1425 300
114 3300042619 Ga0466726_055393 Ga0466726_055393_1848_2759 303
115 3300042612 Ga0466705_099197 Ga0466705_099197_1822_2736 304
116 3300042616 Ga0466715_075770 Ga0466715_075770_3212_4126 304

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03313 SDH_alpha Serine dehydratase alpha chain 17 290 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.