Protein Family IF07638

Metagenome Isolate
220 Members
49 Samples
214 Scaffolds
354.56 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_072459|Ga0466715_072459_339_1586
Length
415 aa
Sequence
MNITVDCRAIGNSGVGVYLRGCLPFFLASSHQFTLLGDRETILASLPGEALRQGKAEFLPCGIKTFSVKELFFFPAPLKRKINKTDIYYSPFFNIPGGIKIPVYCTIHDIVFPDMPELTSKAGLMVRMFFFRRAVKRSKKVFTVSSFSRSRIQHYFGGTIPVIVTYSALQPFFFEPSGDPCQKSKTIVFIGNIKKHKGLNDLLEAFLLARKEGLSHKLIIIGEEKDFRTADSESLKRMNDIGASMVEFTGRLDNESLKRFISRASLLVQPSLYEGFGLPPLEAMALGTKALISDIPVFREIYAGFPVAFFQAGNVRDLKNKLMELLFNQMPETLKLSPELSERYSFKKTSGIVLKEITIQPGSGFAATSPAKPRFGGFLRGFLLNEGVYTPSARKKPRFYFALPPLSWHWHIAAE

📊 Sample Types

Isolate 2.7%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.3%
Kalotermitidae 29.8%
Unclassified 14.9%
Termopsidae 8.5%
Rhinotermitidae 6.4%
Blaberidae 2.1%

🌳 Taxonomy

Archaea 2
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
9 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
10 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
11 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
12 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2772190975 Treponema sp. RmG30 Isolate Blaberidae
25 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
35 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
36 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_104712 3300024493 Bacteria 9960
2 Ga0264413_112831 3300024493 Bacteria 4001
3 Ga0264413_116334 3300024493 Unclassified 3646
4 Ga0466692_017073 3300042591 Bacteria 5923
5 Ga0466691_022042 3300042593 Bacteria 10751
6 Ga0466691_170012 3300042593 Bacteria 38393
7 Ga0466699_401530 3300042597 Bacteria 11190
8 Ga0123353_10252545 3300010167 Bacteria 2730
9 AustNasuHG_c1002278 3300000089 Bacteria 6932
10 AustNasuHG_c1002839 3300000089 Bacteria 6257
11 AustNasuHG_c1002934 3300000089 Bacteria 6142
12 JGI24695J34938_10009239 3300002450 Bacteria 5499
13 Ga0072941_1036072 3300005201 Bacteria 7680
14 Ga0466720_010554 3300042607 Bacteria 31855
15 Ga0466720_178419 3300042607 Bacteria 5234
16 Ga0466735_144152 3300042624 Bacteria 15994
17 Ga0466704_154549 3300042643 Bacteria 24370
18 Ga0466704_177708 3300042643 Bacteria 3514
19 Ga0466727_186408 3300042655 Bacteria 4795
20 Ga0466727_314238 3300042655 Bacteria 4333
21 Ga0466727_314759 3300042655 Bacteria 2903
22 Ga0466712_158108 3300042614 Bacteria 28019
23 Ga0466711_213916 3300042615 Bacteria 3303
24 Ga0466715_067416 3300042616 Bacteria 21033
25 Ga0466715_089505 3300042616 Bacteria 7392
26 Ga0466718_013201 3300042617 Bacteria 3994
27 Ga0466723_037597 3300042618 Unclassified 1948
28 Ga0466723_360442 3300042618 Bacteria 1617
29 Ga0466726_419944 3300042619 Bacteria 1355
30 Ga0466705_266113 3300042612 Bacteria 67009
31 Ga0264413_101011 3300024493 Bacteria 11928
32 Ga0264413_112836 3300024493 Bacteria 2446
33 Ga0466691_025139 3300042593 Bacteria 13400
34 Ga0466696_113527 3300042596 Bacteria 7167
35 Ga0466699_430748 3300042597 Bacteria 5883
36 Ga0123356_10003418 3300010049 Bacteria 16637
37 Ga0123353_10072248 3300010167 Bacteria 5544
38 JGI24698J34947_10037371 3300002449 Bacteria 2523
39 Ga0072941_1032823 3300005201 Bacteria 7773
40 Ga0072941_1044160 3300005201 Bacteria 8911
41 Ga0072941_1083867 3300005201 Bacteria 4409
42 Ga0466719_077112 3300042606 Bacteria 68925
43 Ga0466720_021630 3300042607 Bacteria 14229
44 Ga0466720_041453 3300042607 Bacteria 36391
45 Ga0466735_111791 3300042624 Bacteria 6364
46 Ga0466735_191018 3300042624 Bacteria 3220
47 Ga0466703_060311 3300042636 Bacteria 7814
48 Ga0466703_156433 3300042636 Bacteria 10045
49 Ga0466704_113408 3300042643 Bacteria 8894
50 Ga0466704_134435 3300042643 Bacteria 44988
51 Ga0466712_014319 3300042614 Bacteria 13934
52 Ga0466715_072459 3300042616 Bacteria 1976
53 Ga0466718_006336 3300042617 Bacteria 6262
54 Ga0466718_162500 3300042617 Bacteria 6383
55 Ga0466723_031805 3300042618 Bacteria 21552
56 Ga0466723_303454 3300042618 Bacteria 32258
57 Ga0466726_108366 3300042619 Bacteria 4928
58 Ga0466728_380881 3300042620 Bacteria 39953
59 Ga0466705_059011 3300042612 Bacteria 2635
60 Ga0466705_093800 3300042612 Bacteria 9040
61 Ga0456237_0000455 3300041968 Bacteria 6188
62 Ga0466694_094800 3300042594 Bacteria 1961
63 Ga0466694_406118 3300042594 Archaea 2366
64 Ga0466696_391336 3300042596 Bacteria 16280
65 Ga0123356_10094721 3300010049 Bacteria 2852
66 AustNasuHG_c1025072 3300000089 Unclassified 1879
67 JGI24698J34947_10000533 3300002449 Bacteria 17963
68 JGI24698J34947_10039498 3300002449 Unclassified 2442
69 JGI24695J34938_10000122 3300002450 Bacteria 69892
70 Ga0072941_1034143 3300005201 Bacteria 9043
71 Ga0072941_1168475 3300005201 Bacteria 2415
72 Ga0466707_060120 3300042601 Bacteria 2265
73 Ga0466707_067863 3300042601 Bacteria 11167
74 Ga0466720_036827 3300042607 Bacteria 40262
75 Ga0466720_051715 3300042607 Bacteria 15672
76 Ga0466698_488468 3300042610 Bacteria 10780
77 Ga0466735_154193 3300042624 Unclassified 1867
78 Ga0466735_160876 3300042624 Bacteria 1238
79 Ga0466735_232819 3300042624 Bacteria 8693
80 Ga0466703_158216 3300042636 Bacteria 4064
81 Ga0466709_103879 3300042648 Bacteria 25802
82 Ga0466705_422400 3300042612 Bacteria 19214
83 Ga0466712_066823 3300042614 Bacteria 4785
84 Ga0466718_058641 3300042617 Bacteria 14058
85 Ga0466718_083335 3300042617 Unclassified 2253
86 Ga0466723_114374 3300042618 Bacteria 17921
87 Ga0466726_172656 3300042619 Bacteria 2763
88 Ga0466726_420530 3300042619 Unclassified 1237
89 Ga0264413_102434 3300024493 Bacteria 6935
90 Ga0466690_092360 3300042590 Bacteria 12914
91 Ga0466690_428376 3300042590 Bacteria 2119
92 Ga0466692_059088 3300042591 Bacteria 2936
93 Ga0466692_104444 3300042591 Bacteria 2809
94 Ga0466693_343578 3300042592 Bacteria 18737
95 Ga0466694_231182 3300042594 Bacteria 6356
96 Ga0466694_354846 3300042594 Bacteria 5939
97 Ga0123356_10252391 3300010049 Bacteria 1842
98 Ga0068305_10002349 3300005083 Bacteria 3118
99 Ga0072940_1011213 3300005200 Bacteria 15900
100 Ga0072940_1025539 3300005200 Bacteria 4404
101 Ga0072940_1105775 3300005200 Bacteria 3299
102 Ga0072941_1036973 3300005201 Bacteria 6983
103 Ga0466719_106973 3300042606 Bacteria 29739
104 Ga0466720_078980 3300042607 Bacteria 9261
105 Ga0466720_100415 3300042607 Bacteria 36539
106 Ga0466720_190465 3300042607 Bacteria 3902
107 Ga0466703_334224 3300042636 Bacteria 2120
108 Ga0466704_108328 3300042643 Bacteria 14496
109 Ga0466704_140178 3300042643 Bacteria 60046
110 Ga0466708_153665 3300042652 Bacteria 9204
111 Ga0466712_134403 3300042614 Bacteria 18494
112 Ga0466711_012627 3300042615 Bacteria 16808
113 Ga0466711_124600 3300042615 Bacteria 33924
114 Ga0466715_011664 3300042616 Bacteria 6679
115 Ga0466718_029813 3300042617 Bacteria 16333
116 Ga0466718_036685 3300042617 Bacteria 20442
117 Ga0466718_115546 3300042617 Bacteria 5492
118 Ga0466718_129624 3300042617 Unclassified 5677
119 Ga0466723_046567 3300042618 Unclassified 1269
120 Ga0466726_430132 3300042619 Bacteria 1241
121 Ga0264413_112832 3300024493 Unclassified 3609
122 Ga0456237_0000963 3300041968 Bacteria 4537
123 Ga0466690_094406 3300042590 Bacteria 1962
124 Ga0466692_028277 3300042591 Bacteria 19469
125 Ga0466691_060113 3300042593 Bacteria 13559
126 Ga0466694_071384 3300042594 Bacteria 50432
127 Ga0466694_125782 3300042594 Bacteria 25946
128 Ga0466694_400783 3300042594 Bacteria 7583
129 Ga0466699_047467 3300042597 Bacteria 11573
130 Ga0466699_406412 3300042597 Bacteria 5995
131 AustNasuHG_c1004708 3300000089 Bacteria 4892
132 JGI24695J34938_10000355 3300002450 Bacteria 45167
133 Ga0068302_10555274 3300005071 Bacteria 2423
134 Ga0466720_021975 3300042607 Bacteria 22180
135 Ga0466720_099020 3300042607 Bacteria 25644
136 Ga0466720_211375 3300042607 Bacteria 60841
137 Ga0466703_316619 3300042636 Bacteria 5483
138 Ga0466704_107068 3300042643 Bacteria 5127
139 Ga0466708_197801 3300042652 Bacteria 11963
140 Ga0466715_102568 3300042616 Bacteria 13409
141 Ga0466718_025890 3300042617 Bacteria 19672
142 Ga0466718_089286 3300042617 Bacteria 6803
143 Ga0466718_169172 3300042617 Bacteria 6779
144 Ga0466723_051597 3300042618 Bacteria 3059
145 Ga0466723_296024 3300042618 Bacteria 6069
146 Ga0466726_036784 3300042619 Bacteria 2511
147 Ga0466726_435341 3300042619 Bacteria 4094
148 Ga0466728_026927 3300042620 Bacteria 3111
149 Ga0466728_079530 3300042620 Bacteria 21530
150 Ga0466705_014035 3300042612 Bacteria 13151
151 Ga0466705_044413 3300042612 Bacteria 2923
152 Ga0264413_104713 3300024493 Bacteria 35389
153 Ga0466690_070949 3300042590 Bacteria 4625
154 Ga0466690_192094 3300042590 Unclassified 1399
155 Ga0466692_053953 3300042591 Archaea 2526
156 Ga0466691_115131 3300042593 Bacteria 14787
157 Ga0123354_10193854 3300010882 Unclassified 2263
158 JGI24695J34938_10000006 3300002450 Bacteria 141807
159 JGI24695J34938_10000511 3300002450 Bacteria 37801
160 JGI24695J34938_10003860 3300002450 Bacteria 10159
161 JGI24695J34938_10007305 3300002450 Bacteria 6496
162 JGI24695J34938_10007984 3300002450 Bacteria 6105
163 JGI24702J35022_10000136 3300002462 Bacteria 36676
164 Ga0068305_10003395 3300005083 Bacteria 7081
165 Ga0466700_032644 3300042600 Bacteria 10142
166 Ga0466719_132470 3300042606 Bacteria 7097
167 Ga0466720_043999 3300042607 Bacteria 22878
168 Ga0466720_169943 3300042607 Bacteria 7517
169 Ga0466727_167638 3300042655 Bacteria 1698
170 Ga0466712_174528 3300042614 Bacteria 22450
171 Ga0466712_308114 3300042614 Bacteria 5143
172 Ga0466718_030700 3300042617 Bacteria 5568
173 Ga0466723_260220 3300042618 Unclassified 3471
174 Ga0466723_287526 3300042618 Bacteria 4674
175 Ga0466723_292570 3300042618 Bacteria 2670
176 Ga0466728_003555 3300042620 Bacteria 15475
177 Ga0466728_095239 3300042620 Bacteria 2063
178 Ga0466732_003845 3300042656 Bacteria 7024
179 Ga0466732_161354 3300042656 Bacteria 7138
180 Ga0264413_102690 3300024493 Bacteria 13996
181 Ga0264413_103554 3300024493 Bacteria 7214
182 Ga0264413_104505 3300024493 Bacteria 25126
183 Ga0466691_084797 3300042593 Bacteria 28408
184 Ga0466695_323358 3300042595 Bacteria 2274
185 Ga0466699_019663 3300042597 Bacteria 9677
186 Ga0123353_10488335 3300010167 Bacteria 1799
187 Ga0466700_149841 3300042600 Bacteria 1392
188 Ga0466707_227106 3300042601 Bacteria 6822
189 Ga0466716_526289 3300042605 Bacteria 12332
190 Ga0466722_056201 3300042609 Bacteria 21056
191 Ga0466698_107487 3300042610 Bacteria 3187
192 Ga0466735_082530 3300042624 Bacteria 24525
193 Ga0466708_171131 3300042652 Bacteria 4669
194 Ga0466727_261903 3300042655 Unclassified 1702
195 Ga0466727_262988 3300042655 Bacteria 1420
196 Ga0466712_039347 3300042614 Bacteria 2402
197 Ga0466711_053417 3300042615 Bacteria 6365
198 Ga0466718_051412 3300042617 Bacteria 10135
199 Ga0466718_135665 3300042617 Bacteria 1304
200 Ga0466705_193582 3300042612 Bacteria 8264
201 Ga0466692_061195 3300042591 Bacteria 10800
202 Ga0466692_083406 3300042591 Bacteria 20636
203 Ga0466699_084084 3300042597 Bacteria 21187
204 Ga0123356_10000062 3300010049 Bacteria 112695
205 Ga0072941_1003147 3300005201 Bacteria 83880
206 Ga0466700_206491 3300042600 Bacteria 1211
207 Ga0466716_052445 3300042605 Bacteria 11987
208 Ga0466719_063307 3300042606 Bacteria 5020
209 Ga0466720_028491 3300042607 Bacteria 76920
210 Ga0466720_146320 3300042607 Bacteria 7439
211 Ga0466703_108005 3300042636 Bacteria 23863
212 Ga0466704_207692 3300042643 Bacteria 1878
213 Ga0466715_489021 3300042616 Bacteria 34263
214 Ga0466723_058408 3300042618 Bacteria 16743

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_116334 Ga0264413_1163342 293
2 3300042617 Ga0466718_135665 Ga0466718_135665_203_1225 319
3 3300042612 Ga0466705_093800 Ga0466705_093800_6233_7195 320
4 3300010049 Ga0123356_10252391 Ga0123356_102523912 329
5 3300042617 Ga0466718_029813 Ga0466718_029813_6949_8013 335
6 3300042612 Ga0466705_059011 Ga0466705_059011_679_1698 339
7 3300042593 Ga0466691_022042 Ga0466691_022042_9367_10389 340
8 3300042597 Ga0466699_019663 Ga0466699_019663_5895_6938 340
9 3300042614 Ga0466712_134403 Ga0466712_134403_61_1095 344
10 3300042643 Ga0466704_207692 Ga0466704_207692_187_1224 345
11 3300005201 Ga0072941_1168475 Ga0072941_11684752 346
12 3300024493 Ga0264413_104712 Ga0264413_1047123 346
13 3300042590 Ga0466690_070949 Ga0466690_070949_1268_2308 346
14 3300042593 Ga0466691_170012 Ga0466691_170012_16384_17424 346
15 3300042597 Ga0466699_084084 Ga0466699_084084_10028_11068 346
16 3300042607 Ga0466720_021975 Ga0466720_021975_10122_11162 346
17 3300042607 Ga0466720_078980 Ga0466720_078980_1649_2689 346
18 3300042615 Ga0466711_053417 Ga0466711_053417_405_1445 346
19 3300042636 Ga0466703_316619 Ga0466703_316619_244_1284 346
20 3300000089 AustNasuHG_c1002839 AustNasuHG_10028397 347
21 3300005200 Ga0072940_1025539 Ga0072940_10255392 347
22 3300042594 Ga0466694_125782 Ga0466694_125782_15141_16184 347
23 3300042606 Ga0466719_132470 Ga0466719_132470_4791_5834 347
24 3300042607 Ga0466720_051715 Ga0466720_051715_4974_6017 347
25 3300042607 Ga0466720_190465 Ga0466720_190465_935_1978 347
26 3300042610 Ga0466698_488468 Ga0466698_488468_4733_5776 347
27 3300042614 Ga0466712_308114 Ga0466712_308114_384_1427 347
28 3300042616 Ga0466715_067416 Ga0466715_067416_19867_20910 347
29 3300042617 Ga0466718_025890 Ga0466718_025890_14920_15963 347
30 3300042617 Ga0466718_051412 Ga0466718_051412_1707_2750 347
31 3300042617 Ga0466718_083335 Ga0466718_083335_554_1597 347
32 3300042617 Ga0466718_089286 Ga0466718_089286_5311_6354 347
33 3300042617 Ga0466718_162500 Ga0466718_162500_4146_5189 347
34 3300042617 Ga0466718_169172 Ga0466718_169172_4028_5071 347
35 3300042618 Ga0466723_051597 Ga0466723_051597_1746_2789 347
36 3300042619 Ga0466726_435341 Ga0466726_435341_3033_4076 347
37 3300042624 Ga0466735_160876 Ga0466735_160876_172_1215 347
38 3300042636 Ga0466703_108005 Ga0466703_108005_4518_5561 347
39 3300042643 Ga0466704_107068 Ga0466704_107068_4023_5066 347
40 3300041968 Ga0456237_0000963 Ga0456237_0000963_15_1061 348
41 3300042591 Ga0466692_017073 Ga0466692_017073_662_1708 348
42 3300042594 Ga0466694_071384 Ga0466694_071384_6047_7114 348
43 3300042610 Ga0466698_107487 Ga0466698_107487_1130_2176 348
44 3300042612 Ga0466705_266113 Ga0466705_266113_28700_29746 348
45 3300042615 Ga0466711_012627 Ga0466711_012627_1110_2156 348
46 3300042619 Ga0466726_036784 Ga0466726_036784_203_1276 348
47 3300042619 Ga0466726_430132 Ga0466726_430132_162_1208 348
48 3300042643 Ga0466704_140178 Ga0466704_140178_28473_29519 348
49 3300042594 Ga0466694_406118 Ga0466694_406118_1116_2165 349
50 3300042607 Ga0466720_099020 Ga0466720_099020_3149_4198 349
51 3300042607 Ga0466720_211375 Ga0466720_211375_30451_31500 349
52 3300042612 Ga0466705_193582 Ga0466705_193582_3072_4121 349
53 3300042655 Ga0466727_314759 Ga0466727_314759_966_2015 349
54 3300042591 Ga0466692_028277 Ga0466692_028277_7399_8451 350
55 3300042600 Ga0466700_032644 Ga0466700_032644_3284_4336 350
56 3300042617 Ga0466718_006336 Ga0466718_006336_825_1913 350
57 3300010167 Ga0123353_10072248 Ga0123353_100722483 351
58 3300042601 Ga0466707_060120 Ga0466707_060120_790_1845 351
59 3300042617 Ga0466718_030700 Ga0466718_030700_3610_4695 351
60 3300042636 Ga0466703_158216 Ga0466703_158216_2703_3758 351
61 3300042652 Ga0466708_153665 Ga0466708_153665_7850_8908 352
62 3300024493 Ga0264413_102434 Ga0264413_1024346 353
63 3300024493 Ga0264413_102690 Ga0264413_1026905 353
64 3300042590 Ga0466690_192094 Ga0466690_192094_197_1258 353
65 3300042600 Ga0466700_206491 Ga0466700_206491_68_1129 353
66 3300042606 Ga0466719_106973 Ga0466719_106973_17071_18132 353
67 3300042607 Ga0466720_021630 Ga0466720_021630_10256_11317 353
68 3300042607 Ga0466720_028491 Ga0466720_028491_51596_52657 353
69 3300042618 Ga0466723_046567 Ga0466723_046567_143_1204 353
70 3300042618 Ga0466723_292570 Ga0466723_292570_1571_2632 353
71 3300042620 Ga0466728_079530 Ga0466728_079530_8873_9934 353
72 3300042655 Ga0466727_262988 Ga0466727_262988_101_1162 353
73 iso_pr_bacteria 2772190975 2773721123 353
74 iso_pr_bacteria 2781125635 2781276499 353
75 iso_pr_bacteria 2781125645 2781297678 353
76 3300002450 JGI24695J34938_10000006 JGI24695J34938_10000006120 354
77 3300024493 Ga0264413_104713 Ga0264413_1047139 354
78 3300024493 Ga0264413_112832 Ga0264413_1128322 354
79 3300041968 Ga0456237_0000455 Ga0456237_0000455_2307_3371 354
80 3300042591 Ga0466692_061195 Ga0466692_061195_7241_8305 354
81 3300042591 Ga0466692_104444 Ga0466692_104444_1101_2165 354
82 3300042593 Ga0466691_060113 Ga0466691_060113_5188_6252 354
83 3300042597 Ga0466699_406412 Ga0466699_406412_4086_5150 354
84 3300042605 Ga0466716_052445 Ga0466716_052445_2193_3257 354
85 3300042605 Ga0466716_526289 Ga0466716_526289_3406_4470 354
86 3300042609 Ga0466722_056201 Ga0466722_056201_14499_15563 354
87 3300042614 Ga0466712_158108 Ga0466712_158108_14553_15617 354
88 3300042614 Ga0466712_174528 Ga0466712_174528_4800_5864 354
89 3300042616 Ga0466715_489021 Ga0466715_489021_30638_31702 354
90 3300042617 Ga0466718_058641 Ga0466718_058641_12880_13944 354
91 3300042618 Ga0466723_058408 Ga0466723_058408_2307_3371 354
92 3300042618 Ga0466723_114374 Ga0466723_114374_4412_5476 354
93 3300042618 Ga0466723_296024 Ga0466723_296024_1528_2592 354
94 3300042619 Ga0466726_172656 Ga0466726_172656_1326_2390 354
95 3300042620 Ga0466728_026927 Ga0466728_026927_1303_2367 354
96 3300042636 Ga0466703_156433 Ga0466703_156433_3375_4439 354
97 3300042643 Ga0466704_154549 Ga0466704_154549_6445_7509 354
98 iso_pr_bacteria 2781125660 2781330253 354
99 3300000089 AustNasuHG_c1004708 AustNasuHG_10047083 355
100 3300002450 JGI24695J34938_10003860 JGI24695J34938_100038604 355
101 3300005201 Ga0072941_1044160 Ga0072941_10441602 355
102 3300010049 Ga0123356_10000062 Ga0123356_1000006246 355
103 3300010167 Ga0123353_10488335 Ga0123353_104883352 355
104 3300024493 Ga0264413_103554 Ga0264413_1035542 355
105 3300042590 Ga0466690_092360 Ga0466690_092360_4590_5657 355
106 3300042594 Ga0466694_400783 Ga0466694_400783_4871_5938 355
107 3300042596 Ga0466696_113527 Ga0466696_113527_5895_6962 355
108 3300042597 Ga0466699_430748 Ga0466699_430748_2052_3119 355
109 3300042614 Ga0466712_014319 Ga0466712_014319_11768_12835 355
110 3300042614 Ga0466712_039347 Ga0466712_039347_237_1304 355
111 3300042616 Ga0466715_011664 Ga0466715_011664_4235_5302 355
112 3300042616 Ga0466715_102568 Ga0466715_102568_1257_2324 355
113 3300042617 Ga0466718_115546 Ga0466718_115546_1775_2842 355
114 3300042618 Ga0466723_031805 Ga0466723_031805_4292_5359 355
115 3300042655 Ga0466727_167638 Ga0466727_167638_164_1231 355
116 iso_pr_bacteria 2781125632 2781269447 355
117 3300000089 AustNasuHG_c1002278 AustNasuHG_10022782 356
118 3300002449 JGI24698J34947_10000533 JGI24698J34947_1000053313 356
119 3300002449 JGI24698J34947_10037371 JGI24698J34947_100373712 356
120 3300002450 JGI24695J34938_10000122 JGI24695J34938_1000012228 356
121 3300002450 JGI24695J34938_10007305 JGI24695J34938_100073054 356
122 3300005200 Ga0072940_1011213 Ga0072940_101121312 356
123 3300005201 Ga0072941_1032823 Ga0072941_10328237 356
124 3300010049 Ga0123356_10094721 Ga0123356_100947213 356
125 3300042592 Ga0466693_343578 Ga0466693_343578_17540_18610 356
126 3300042594 Ga0466694_354846 Ga0466694_354846_4547_5617 356
127 3300042595 Ga0466695_323358 Ga0466695_323358_470_1540 356
128 3300042597 Ga0466699_047467 Ga0466699_047467_2741_3811 356
129 3300042597 Ga0466699_401530 Ga0466699_401530_6484_7554 356
130 3300042600 Ga0466700_149841 Ga0466700_149841_274_1344 356
131 3300042601 Ga0466707_227106 Ga0466707_227106_816_1886 356
132 3300042607 Ga0466720_036827 Ga0466720_036827_16080_17150 356
133 3300042607 Ga0466720_178419 Ga0466720_178419_3300_4370 356
134 3300042618 Ga0466723_287526 Ga0466723_287526_190_1260 356
135 3300042624 Ga0466735_082530 Ga0466735_082530_2502_3572 356
136 3300042643 Ga0466704_177708 Ga0466704_177708_1524_2594 356
137 3300042652 Ga0466708_197801 Ga0466708_197801_10001_11071 356
138 3300042655 Ga0466727_261903 Ga0466727_261903_321_1391 356
139 3300002450 JGI24695J34938_10007984 JGI24695J34938_100079844 357
140 3300002462 JGI24702J35022_10000136 JGI24702J35022_1000013619 357
141 3300005201 Ga0072941_1003147 Ga0072941_100314740 357
142 3300005201 Ga0072941_1034143 Ga0072941_10341432 357
143 3300005201 Ga0072941_1036072 Ga0072941_10360724 357
144 3300010167 Ga0123353_10252545 Ga0123353_102525453 357
145 3300042619 Ga0466726_108366 Ga0466726_108366_3291_4364 357
146 3300042620 Ga0466728_380881 Ga0466728_380881_22016_23089 357
147 3300042655 Ga0466727_186408 Ga0466727_186408_901_1974 357
148 3300042655 Ga0466727_314238 Ga0466727_314238_452_1525 357
149 3300042656 Ga0466732_161354 Ga0466732_161354_3675_4748 357
150 3300002450 JGI24695J34938_10000355 JGI24695J34938_1000035527 358
151 3300010049 Ga0123356_10003418 Ga0123356_100034185 358
152 3300042590 Ga0466690_428376 Ga0466690_428376_524_1600 358
153 3300042593 Ga0466691_115131 Ga0466691_115131_12516_13592 358
154 3300042596 Ga0466696_391336 Ga0466696_391336_10316_11392 358
155 3300042614 Ga0466712_066823 Ga0466712_066823_2287_3363 358
156 3300042617 Ga0466718_013201 Ga0466718_013201_2217_3293 358
157 3300042618 Ga0466723_037597 Ga0466723_037597_76_1152 358
158 3300042618 Ga0466723_260220 Ga0466723_260220_1565_2641 358
159 3300042618 Ga0466723_360442 Ga0466723_360442_151_1227 358
160 3300042620 Ga0466728_003555 Ga0466728_003555_10779_11855 358
161 3300042620 Ga0466728_095239 Ga0466728_095239_299_1375 358
162 3300042636 Ga0466703_334224 Ga0466703_334224_716_1792 358
163 3300042643 Ga0466704_108328 Ga0466704_108328_10079_11155 358
164 3300042652 Ga0466708_171131 Ga0466708_171131_813_1889 358
165 3300042656 Ga0466732_003845 Ga0466732_003845_3379_4455 358
166 3300005201 Ga0072941_1036973 Ga0072941_10369739 359
167 3300010882 Ga0123354_10193854 Ga0123354_101938541 359
168 3300024493 Ga0264413_104505 Ga0264413_1045056 359
169 3300042606 Ga0466719_063307 Ga0466719_063307_471_1550 359
170 3300042607 Ga0466720_010554 Ga0466720_010554_24811_25890 359
171 3300042636 Ga0466703_060311 Ga0466703_060311_3579_4673 359
172 3300002450 JGI24695J34938_10009239 JGI24695J34938_100092394 360
173 3300005083 Ga0068305_10002349 Ga0068305_100023493 360
174 3300024493 Ga0264413_101011 Ga0264413_1010112 360
175 3300024493 Ga0264413_112831 Ga0264413_1128312 360
176 3300042590 Ga0466690_094406 Ga0466690_094406_221_1303 360
177 3300042593 Ga0466691_084797 Ga0466691_084797_26324_27406 360
178 3300042594 Ga0466694_231182 Ga0466694_231182_2474_3556 360
179 3300042606 Ga0466719_077112 Ga0466719_077112_24216_25325 360
180 3300042607 Ga0466720_041453 Ga0466720_041453_2697_3779 360
181 3300042607 Ga0466720_100415 Ga0466720_100415_24054_25136 360
182 3300042607 Ga0466720_146320 Ga0466720_146320_4249_5331 360
183 3300042612 Ga0466705_044413 Ga0466705_044413_1815_2897 360
184 3300042618 Ga0466723_303454 Ga0466723_303454_28517_29599 360
185 3300042619 Ga0466726_419944 Ga0466726_419944_132_1214 360
186 3300042619 Ga0466726_420530 Ga0466726_420530_123_1205 360
187 3300002450 JGI24695J34938_10000511 JGI24695J34938_100005118 361
188 3300042593 Ga0466691_025139 Ga0466691_025139_11758_12843 361
189 3300042601 Ga0466707_067863 Ga0466707_067863_9248_10333 361
190 3300042607 Ga0466720_043999 Ga0466720_043999_16547_17632 361
191 3300042607 Ga0466720_169943 Ga0466720_169943_5046_6131 361
192 3300042612 Ga0466705_014035 Ga0466705_014035_8793_9878 361
193 3300042616 Ga0466715_089505 Ga0466715_089505_4026_5111 361
194 3300042624 Ga0466735_154193 Ga0466735_154193_330_1415 361
195 3300042643 Ga0466704_134435 Ga0466704_134435_8565_9650 361
196 3300042648 Ga0466709_103879 Ga0466709_103879_10494_11579 361
197 3300000089 AustNasuHG_c1002934 AustNasuHG_10029344 362
198 3300000089 AustNasuHG_c1025072 AustNasuHG_10250722 362
199 3300005200 Ga0072940_1105775 Ga0072940_11057752 362
200 3300024493 Ga0264413_112836 Ga0264413_1128362 362
201 3300042591 Ga0466692_053953 Ga0466692_053953_172_1260 362
202 3300042591 Ga0466692_059088 Ga0466692_059088_360_1448 362
203 3300042615 Ga0466711_124600 Ga0466711_124600_20074_21162 362
204 3300005201 Ga0072941_1083867 Ga0072941_10838673 363
205 3300042612 Ga0466705_422400 Ga0466705_422400_14496_15587 363
206 3300042624 Ga0466735_111791 Ga0466735_111791_2389_3480 363
207 3300042624 Ga0466735_232819 Ga0466735_232819_3187_4278 363
208 iso_pr_bacteria 2820020240 2820020386 363
209 3300005083 Ga0068305_10003395 Ga0068305_100033956 364
210 3300042594 Ga0466694_094800 Ga0466694_094800_437_1531 364
211 3300042615 Ga0466711_213916 Ga0466711_213916_804_1901 365
212 3300042624 Ga0466735_191018 Ga0466735_191018_464_1564 366
213 3300042643 Ga0466704_113408 Ga0466704_113408_4121_5221 366
214 3300042617 Ga0466718_129624 Ga0466718_129624_2791_3894 367
215 3300002449 JGI24698J34947_10039498 JGI24698J34947_100394982 368
216 3300042591 Ga0466692_083406 Ga0466692_083406_10500_11618 372
217 3300042617 Ga0466718_036685 Ga0466718_036685_319_1440 373
218 3300042624 Ga0466735_144152 Ga0466735_144152_12731_13867 378
219 3300005071 Ga0068302_10555274 Ga0068302_105552741 390
220 3300042616 Ga0466715_072459 Ga0466715_072459_339_1586 415

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00534 Glycos_transf_1 Glycosyl transferases group 1 182 329 0.89
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 185 326 0.83
PF20706 GT4-conflict Family 4 Glycosyltransferase in conflict systems 167 293 0.78

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00534 GO:0016757 glycosyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.