Protein Family IF07632

Metagenome Isolate
129 Members
61 Samples
108 Scaffolds
339.98 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_063666|Ga0466715_063666_15428_16579
Length
383 aa
Sequence
MRGKDRSIFLNKQSFSTLILKKKIVHLQPISDFQLNIFMNKQKRMKGFILAGAVLFFIFAAGTGIYRLLYAPGFANKETVYLYIDRQIGFDKLCRLLTDSAGISRPDDFKLLARLLKYPENMKTGKYALTPGMSYPALLNQLRRGQQATTRLTFHNIRFLDDLAGRIAEQLMIGKEELLQWLNDPDYCRSLGFTTETIGALFIPDTYEVYWNITAENLLQRMKREYDAFWTEERKQKAADIHLTPVETAILASVVEEETAAADEYPVVAGLYLNRLRQGIPLQADPTIRFAVGDYALRRILFEHLAIESPYNTYKYAGLPPGLLRIPSARGIDGVLNHAKHHYLYMCAKEDLSGRHNFAVTLAEHNRNANRYHAELNRRNIRR

📊 Sample Types

Isolate 16.3%
Metagenome 83.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 29.5%
Termitidae 23.0%
Kalotermitidae 23.0%
Unclassified 8.2%
Termopsidae 6.6%
Passalidae 4.9%
Rhinotermitidae 4.9%

🌳 Taxonomy

Archaea 0
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
2 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
3 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
6 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2923982719 Parabacteroides sp. 52 Isolate Blattidae
16 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
17 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
18 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
27 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
33 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
34 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
46 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
47 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
48 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
50 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
51 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
52 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
53 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
54 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
56 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
57 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
59 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
60 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
61 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_257385 3300042590 Bacteria 42272
2 Ga0466696_308319 3300042596 Bacteria 10176
3 Ga0466711_098141 3300042615 Bacteria 9099
4 Ga0466703_321665 3300042636 Bacteria 9300
5 Ga0466704_036325 3300042643 Bacteria 3788
6 Ga0466708_055182 3300042652 Bacteria 25285
7 2227616573 2225789004 Unclassified 2220
8 Ga0068305_10077693 3300005083 Bacteria 5822
9 Ga0466719_273928 3300042606 Bacteria 14279
10 Ga0466722_091268 3300042609 Bacteria 4441
11 Ga0466690_140674 3300042590 Bacteria 11087
12 Ga0466690_353947 3300042590 Bacteria 2202
13 Ga0466723_199512 3300042618 Bacteria 25184
14 Ga0466703_164790 3300042636 Bacteria 7658
15 Ga0466704_224558 3300042643 Bacteria 6374
16 Ga0466725_269633 3300042654 Bacteria 4033
17 Ga0466727_174461 3300042655 Bacteria 4855
18 IMNBL1DRAFT_c0006049 3300000062 Bacteria 6735
19 JGI24702J35022_10010583 3300002462 Bacteria 5152
20 Ga0466705_235919 3300042612 Bacteria 1229
21 Ga0466733_057416 3300042659 Bacteria 1603
22 Ga0466713_143316 3300042602 Bacteria 9021
23 Ga0466716_129706 3300042605 Bacteria 33732
24 Ga0123353_10285591 3300010167 Bacteria 2530
25 Ga0123353_10481013 3300010167 Bacteria 1817
26 Ga0466711_122242 3300042615 Bacteria 14556
27 Ga0466711_268760 3300042615 Bacteria 28251
28 Ga0466715_092286 3300042616 Bacteria 33475
29 Ga0466726_219663 3300042619 Bacteria 2863
30 Ga0466728_437804 3300042620 Bacteria 5594
31 Ga0466704_010233 3300042643 Bacteria 10792
32 Ga0466704_027865 3300042643 Bacteria 11545
33 2226980355 2225789003 Bacteria 55379
34 IMNBL1DRAFT_c0004201 3300000062 Bacteria 8755
35 JGI24702J35022_10001318 3300002462 Bacteria 15429
36 JGI24702J35022_10093428 3300002462 Bacteria 1639
37 Ga0068302_10242252 3300005071 Unclassified 2944
38 Ga0466733_010887 3300042659 Bacteria 32155
39 Ga0466700_292196 3300042600 Bacteria 1055
40 Ga0466707_314240 3300042601 Unclassified 9485
41 Ga0466713_027932 3300042602 Bacteria 1721
42 Ga0466722_207358 3300042609 Bacteria 4449
43 Ga0466693_118557 3300042592 Bacteria 1551
44 Ga0466691_053101 3300042593 Bacteria 25087
45 Ga0466696_253581 3300042596 Bacteria 5278
46 Ga0123356_10097074 3300010049 Bacteria 2819
47 Ga0123353_10229361 3300010167 Bacteria 2897
48 Ga0466705_393530 3300042612 Bacteria 4738
49 Ga0466711_070880 3300042615 Bacteria 5017
50 Ga0466726_339380 3300042619 Bacteria 5121
51 JGI24705J35276_12237768 3300002504 Bacteria 13008
52 Ga0068305_10031664 3300005083 Bacteria 1788
53 Ga0466690_010102 3300042590 Bacteria 8086
54 Ga0466690_120915 3300042590 Bacteria 6452
55 Ga0466690_335590 3300042590 Bacteria 22756
56 Ga0466692_001194 3300042591 Bacteria 22639
57 Ga0466691_064032 3300042593 Bacteria 10151
58 Ga0466694_173008 3300042594 Unclassified 5801
59 Ga0466696_138910 3300042596 Bacteria 20976
60 Ga0466711_044618 3300042615 Bacteria 7934
61 Ga0466711_110428 3300042615 Bacteria 6088
62 Ga0466711_166018 3300042615 Bacteria 12568
63 Ga0466723_138254 3300042618 Bacteria 9536
64 Ga0466735_027660 3300042624 Bacteria 1982
65 Ga0466703_056068 3300042636 Bacteria 14255
66 Ga0466704_497222 3300042643 Bacteria 26011
67 Ga0466727_036087 3300042655 Bacteria 7375
68 Ga0466727_084410 3300042655 Bacteria 5467
69 2227325220 2225789004 Unclassified 6380
70 JGI24702J35022_10082890 3300002462 Bacteria 1738
71 Ga0466705_211933 3300042612 Bacteria 2299
72 Ga0466733_014671 3300042659 Bacteria 9258
73 Ga0466713_120191 3300042602 Bacteria 32830
74 Ga0466713_154972 3300042602 Bacteria 7839
75 Ga0466716_472100 3300042605 Bacteria 6771
76 Ga0466722_009411 3300042609 Bacteria 53238
77 Ga0466696_172220 3300042596 Bacteria 1458
78 Ga0466710_147361 3300042613 Bacteria 3052
79 Ga0466715_063666 3300042616 Bacteria 17036
80 Ga0466723_352261 3300042618 Bacteria 20141
81 Ga0466703_387347 3300042636 Bacteria 8055
82 JGI24702J35022_10000076 3300002462 Bacteria 43662
83 JGI24702J35022_10041696 3300002462 Bacteria 2446
84 JGI24702J35022_10051961 3300002462 Bacteria 2184
85 Ga0466713_047935 3300042602 Bacteria 3006
86 Ga0466713_115337 3300042602 Bacteria 64305
87 Ga0466716_068742 3300042605 Bacteria 11694
88 Ga0466721_310708 3300042608 Bacteria 1456
89 Ga0466722_002247 3300042609 Bacteria 7774
90 Ga0466698_123156 3300042610 Bacteria 2350
91 Ga0466692_008187 3300042591 Bacteria 121981
92 Ga0466691_127025 3300042593 Bacteria 45490
93 Ga0466691_136916 3300042593 Bacteria 1763
94 Ga0466696_038684 3300042596 Bacteria 3169
95 Ga0466715_554442 3300042616 Bacteria 6708
96 Ga0466735_214654 3300042624 Bacteria 1751
97 Ga0466709_353363 3300042648 Bacteria 2034
98 2227225249 2225789004 Bacteria 7435
99 Ga0466700_478434 3300042600 Bacteria 2945
100 Ga0466707_118980 3300042601 Bacteria 8459
101 Ga0466711_083575 3300042615 Bacteria 31587
102 Ga0466718_002827 3300042617 Unclassified 1227
103 Ga0466728_231085 3300042620 Bacteria 2455
104 Ga0466731_241898 3300042622 Bacteria 5509
105 Ga0466703_143580 3300042636 Bacteria 20242
106 Ga0466709_268274 3300042648 Bacteria 6622
107 Ga0068302_10806601 3300005071 Bacteria 1238
108 Ga0068305_10003923 3300005083 Unclassified 2374

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005083 Ga0068305_10003923 Ga0068305_100039231 299
2 3300042615 Ga0466711_268760 Ga0466711_268760_18509_19435 308
3 3300042624 Ga0466735_214654 Ga0466735_214654_76_1035 311
4 3300042652 Ga0466708_055182 Ga0466708_055182_12179_13210 311
5 3300042590 Ga0466690_335590 Ga0466690_335590_4545_5486 313
6 3300042596 Ga0466696_038684 Ga0466696_038684_2036_2977 313
7 3300042636 Ga0466703_143580 Ga0466703_143580_18999_19940 313
8 3300042591 Ga0466692_008187 Ga0466692_008187_90670_91614 314
9 3300042600 Ga0466700_292196 Ga0466700_292196_89_1036 315
10 3300042617 Ga0466718_002827 Ga0466718_002827_218_1165 315
11 3300042592 Ga0466693_118557 Ga0466693_118557_187_1221 317
12 3300042622 Ga0466731_241898 Ga0466731_241898_3087_4121 320
13 3300042608 Ga0466721_310708 Ga0466721_310708_137_1171 321
14 2225789004 2227225249 2227659606 322
15 3300042609 Ga0466722_002247 Ga0466722_002247_3196_4236 325
16 3300042615 Ga0466711_166018 Ga0466711_166018_5508_6488 326
17 3300010167 Ga0123353_10285591 Ga0123353_102855911 327
18 3300042659 Ga0466733_057416 Ga0466733_057416_84_1127 327
19 3300002462 JGI24702J35022_10001318 JGI24702J35022_100013186 328
20 3300042619 Ga0466726_219663 Ga0466726_219663_305_1291 328
21 3300042594 Ga0466694_173008 Ga0466694_173008_469_1524 329
22 3300042600 Ga0466700_478434 Ga0466700_478434_1673_2698 329
23 3300042616 Ga0466715_554442 Ga0466715_554442_3502_4527 329
24 3300042618 Ga0466723_199512 Ga0466723_199512_19505_20494 329
25 3300002462 JGI24702J35022_10010583 JGI24702J35022_100105832 330
26 3300042596 Ga0466696_172220 Ga0466696_172220_186_1226 330
27 3300042601 Ga0466707_118980 Ga0466707_118980_3271_4299 330
28 3300042606 Ga0466719_273928 Ga0466719_273928_1862_2884 330
29 3300005083 Ga0068305_10077693 Ga0068305_100776933 331
30 3300042636 Ga0466703_321665 Ga0466703_321665_5616_6644 331
31 3300042619 Ga0466726_339380 Ga0466726_339380_1992_3017 333
32 3300042643 Ga0466704_224558 Ga0466704_224558_738_1739 333
33 3300002462 JGI24702J35022_10093428 JGI24702J35022_100934282 334
34 3300005071 Ga0068302_10242252 Ga0068302_102422522 334
35 3300042615 Ga0466711_044618 Ga0466711_044618_1301_2329 334
36 3300042601 Ga0466707_314240 Ga0466707_314240_5073_6098 335
37 3300042602 Ga0466713_047935 Ga0466713_047935_574_1623 336
38 3300010167 Ga0123353_10481013 Ga0123353_104810132 338
39 3300042596 Ga0466696_253581 Ga0466696_253581_3614_4630 338
40 3300010167 Ga0123353_10229361 Ga0123353_102293612 339
41 3300042593 Ga0466691_064032 Ga0466691_064032_4979_6001 340
42 3300042596 Ga0466696_308319 Ga0466696_308319_1196_2236 340
43 3300042605 Ga0466716_129706 Ga0466716_129706_17058_18080 340
44 3300042616 Ga0466715_092286 Ga0466715_092286_21338_22360 340
45 3300042636 Ga0466703_164790 Ga0466703_164790_1468_2490 340
46 3300042590 Ga0466690_120915 Ga0466690_120915_4648_5673 341
47 3300042593 Ga0466691_136916 Ga0466691_136916_128_1153 341
48 3300042609 Ga0466722_091268 Ga0466722_091268_3071_4117 341
49 3300042610 Ga0466698_123156 Ga0466698_123156_756_1814 341
50 3300042612 Ga0466705_235919 Ga0466705_235919_185_1210 341
51 3300042612 Ga0466705_393530 Ga0466705_393530_1032_2057 341
52 3300042618 Ga0466723_352261 Ga0466723_352261_2687_3712 341
53 3300042620 Ga0466728_437804 Ga0466728_437804_3840_4865 341
54 3300042643 Ga0466704_010233 Ga0466704_010233_9172_10197 341
55 3300042643 Ga0466704_027865 Ga0466704_027865_1695_2720 341
56 3300042655 Ga0466727_036087 Ga0466727_036087_4648_5673 341
57 3300042655 Ga0466727_084410 Ga0466727_084410_3829_4854 341
58 3300005071 Ga0068302_10806601 Ga0068302_108066011 342
59 3300042590 Ga0466690_140674 Ga0466690_140674_526_1554 342
60 3300042605 Ga0466716_068742 Ga0466716_068742_603_1631 342
61 3300042605 Ga0466716_472100 Ga0466716_472100_4597_5625 342
62 3300042615 Ga0466711_098141 Ga0466711_098141_4577_5605 342
63 3300042615 Ga0466711_110428 Ga0466711_110428_4036_5082 342
64 3300042636 Ga0466703_387347 Ga0466703_387347_6283_7311 342
65 3300042648 Ga0466709_353363 Ga0466709_353363_662_1690 342
66 3300042612 Ga0466705_211933 Ga0466705_211933_160_1191 343
67 3300042615 Ga0466711_122242 Ga0466711_122242_8409_9440 343
68 3300042643 Ga0466704_497222 Ga0466704_497222_24214_25245 343
69 iso_pr_bacteria 2695420317 2695485335 343
70 iso_pr_bacteria 8100157865 8100159255 343
71 3300042602 Ga0466713_120191 Ga0466713_120191_28618_29652 344
72 3300042613 Ga0466710_147361 Ga0466710_147361_1860_2894 344
73 3300042590 Ga0466690_010102 Ga0466690_010102_3505_4542 345
74 3300042593 Ga0466691_127025 Ga0466691_127025_24381_25418 345
75 3300042648 Ga0466709_268274 Ga0466709_268274_2146_3183 345
76 3300042655 Ga0466727_174461 Ga0466727_174461_2132_3169 345
77 3300000062 IMNBL1DRAFT_c0006049 IMNBL1DRAFT_00060497 346
78 3300002462 JGI24702J35022_10051961 JGI24702J35022_100519611 346
79 3300002504 JGI24705J35276_12237768 JGI24705J35276_1223776810 346
80 3300010049 Ga0123356_10097074 Ga0123356_100970742 346
81 3300042602 Ga0466713_115337 Ga0466713_115337_56263_57303 346
82 3300042618 Ga0466723_138254 Ga0466723_138254_3564_4604 346
83 3300042636 Ga0466703_056068 Ga0466703_056068_195_1235 346
84 3300005083 Ga0068305_10031664 Ga0068305_100316641 347
85 3300042596 Ga0466696_138910 Ga0466696_138910_806_1849 347
86 3300042609 Ga0466722_009411 Ga0466722_009411_43198_44241 347
87 3300042609 Ga0466722_207358 Ga0466722_207358_3126_4169 347
88 iso_pr_bacteria 2923982719 2923983392 347
89 iso_pr_bacteria 2940199050 2940200235 347
90 iso_pr_bacteria 2940205530 2940206376 347
91 iso_pr_bacteria 2940209341 2940209613 347
92 iso_pr_bacteria 2940212447 2940213349 347
93 iso_pr_bacteria 2940298504 2940299347 347
94 iso_pr_bacteria 2940302308 2940303210 347
95 iso_pr_bacteria 2940306115 2940306892 347
96 iso_pr_bacteria 2940309933 2940310709 347
97 iso_pr_bacteria 2940313741 2940314576 347
98 iso_pr_bacteria 2940317558 2940318391 347
99 iso_pr_bacteria 2940321370 2940322203 347
100 iso_pr_bacteria 2940325180 2940326082 347
101 iso_pr_bacteria 2940328985 2940329830 347
102 iso_pr_bacteria 2940332795 2940333572 347
103 iso_pr_bacteria 2940346213 2940347852 347
104 iso_pr_bacteria 2940371297 2940371323 347
105 3300000062 IMNBL1DRAFT_c0004201 IMNBL1DRAFT_00042014 348
106 3300002462 JGI24702J35022_10000076 JGI24702J35022_1000007620 348
107 3300042590 Ga0466690_353947 Ga0466690_353947_111_1157 348
108 3300042591 Ga0466692_001194 Ga0466692_001194_264_1310 348
109 3300042593 Ga0466691_053101 Ga0466691_053101_662_1708 348
110 3300042615 Ga0466711_083575 Ga0466711_083575_15937_16983 348
111 3300042620 Ga0466728_231085 Ga0466728_231085_312_1358 348
112 3300042654 Ga0466725_269633 Ga0466725_269633_2257_3303 348
113 3300042659 Ga0466733_014671 Ga0466733_014671_2902_3948 348
114 iso_pr_bacteria 2820744581 2820744592 348
115 iso_pr_bacteria 2940195863 2940196072 348
116 3300002462 JGI24702J35022_10041696 JGI24702J35022_100416962 349
117 3300042602 Ga0466713_143316 Ga0466713_143316_2178_3227 349
118 3300042624 Ga0466735_027660 Ga0466735_027660_613_1662 349
119 2225789003 2226980355 2227324068 350
120 2225789004 2227325220 2227773123 350
121 2225789004 2227616573 2228191817 350
122 3300042602 Ga0466713_027932 Ga0466713_027932_279_1337 352
123 3300002462 JGI24702J35022_10082890 JGI24702J35022_100828901 353
124 3300042659 Ga0466733_010887 Ga0466733_010887_24599_25666 355
125 3300042590 Ga0466690_257385 Ga0466690_257385_19132_20214 360
126 3300042643 Ga0466704_036325 Ga0466704_036325_180_1262 360
127 3300042602 Ga0466713_154972 Ga0466713_154972_56_1219 370
128 3300042615 Ga0466711_070880 Ga0466711_070880_1456_2604 374
129 3300042616 Ga0466715_063666 Ga0466715_063666_15428_16579 383

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02618 YceG YceG-like family 83 370 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.