Protein Family IF07603

Metagenome Isolate
109 Members
31 Samples
107 Scaffolds
188.87 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_013332|Ga0466715_013332_2347_3039
Length
230 aa
Sequence
MKRTFGAPPAVQAAEAGKESQSVTRAGSRPFARGSNLFLTGRMRLTVFISMILFSFMAGTVLAAETREDKSDMLVVYFSWSGNTRGIAKEIHQKVGGDIVEIELVKPYSSNYNTCLDEAKRDQEIQARPALKNHIADMGKYDVIFLGYPNWWASIPMPIASFLEKYDLSGKTIIPFCSHGGGRLGQSVSAIAKLSPRSKILEALSIHYSGGSSLRNDISAWLRKVGIEEK

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 45.2%
Termitidae 22.6%
Unclassified 16.1%
Rhinotermitidae 9.7%
Termopsidae 6.5%

🌳 Taxonomy

Archaea 2
Bacteria 95
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
2 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
3 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
4 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
5 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
31 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_152734 3300042606 Bacteria 4800
2 Ga0466722_168594 3300042609 Bacteria 2212
3 Ga0466691_065156 3300042593 Bacteria 3478
4 Ga0466691_217802 3300042593 Bacteria 1316
5 Ga0466708_124717 3300042652 Bacteria 8055
6 Ga0466711_141081 3300042615 Bacteria 14492
7 Ga0466715_029050 3300042616 Bacteria 1063
8 Ga0466715_040587 3300042616 Bacteria 1350
9 Ga0466723_094133 3300042618 Bacteria 3327
10 Ga0466723_186007 3300042618 Bacteria 2607
11 Ga0466728_036315 3300042620 Bacteria 1150
12 Ga0466729_165676 3300042621 Bacteria 3381
13 JGI24697J35500_11274490 3300002507 Bacteria 7480
14 Ga0068305_10214534 3300005083 Bacteria 5040
15 Ga0466713_127166 3300042602 Bacteria 3321
16 Ga0466716_183019 3300042605 Archaea 1895
17 Ga0466690_336160 3300042590 Bacteria 1218
18 Ga0466691_031131 3300042593 Bacteria 14718
19 Ga0466691_101000 3300042593 Bacteria 16184
20 Ga0466729_239241 3300042621 Bacteria 1967
21 Ga0466704_494350 3300042643 Bacteria 3603
22 Ga0466708_367907 3300042652 Bacteria 1204
23 Ga0466727_018809 3300042655 Bacteria 3983
24 Ga0466727_172020 3300042655 Bacteria 2852
25 Ga0466712_088820 3300042614 Bacteria 2932
26 Ga0466711_448853 3300042615 Bacteria 3003
27 Ga0466715_503867 3300042616 Bacteria 1160
28 Ga0466723_179250 3300042618 Bacteria 11620
29 Ga0466726_008970 3300042619 Bacteria 2350
30 JGI24698J34947_10020660 3300002449 Unclassified 3544
31 Ga0466707_023635 3300042601 Bacteria 2941
32 Ga0466713_056591 3300042602 Bacteria 24570
33 Ga0466719_103894 3300042606 Unclassified 1044
34 Ga0466702_405472 3300042635 Unclassified 1855
35 Ga0466704_015084 3300042643 Bacteria 1005
36 Ga0466709_214076 3300042648 Bacteria 1325
37 Ga0466715_207235 3300042616 Bacteria 1444
38 Ga0466715_261338 3300042616 Unclassified 1547
39 Ga0466715_275550 3300042616 Bacteria 1392
40 Ga0466723_050188 3300042618 Bacteria 10753
41 Ga0466723_147133 3300042618 Bacteria 2315
42 Ga0466726_020528 3300042619 Bacteria 5855
43 Ga0466726_063690 3300042619 Bacteria 2953
44 Ga0466726_433005 3300042619 Bacteria 3894
45 Ga0466705_180006 3300042612 Bacteria 14139
46 Ga0466719_181010 3300042606 Bacteria 14792
47 Ga0466690_108394 3300042590 Bacteria 2058
48 Ga0466696_239211 3300042596 Bacteria 5455
49 Ga0466704_250391 3300042643 Unclassified 1346
50 Ga0466712_052492 3300042614 Bacteria 3792
51 Ga0466715_013332 3300042616 Bacteria 3353
52 Ga0466715_327506 3300042616 Bacteria 1015
53 Ga0466723_194322 3300042618 Bacteria 8112
54 Ga0466726_027505 3300042619 Bacteria 1511
55 JGI24699J35502_10866751 3300002509 Bacteria 982
56 Ga0466704_104121 3300042643 Archaea 1459
57 Ga0466709_003678 3300042648 Bacteria 12521
58 Ga0466709_103948 3300042648 Bacteria 1823
59 Ga0466712_113651 3300042614 Bacteria 1919
60 Ga0466711_161966 3300042615 Bacteria 6259
61 JGI24698J34947_10004291 3300002449 Unclassified 7758
62 JGI24698J34947_10082969 3300002449 Unclassified 1497
63 JGI24698J34947_10113620 3300002449 Bacteria 1190
64 JGI24702J35022_10107981 3300002462 Bacteria 1529
65 Ga0466707_304359 3300042601 Bacteria 1657
66 Ga0466719_151859 3300042606 Bacteria 4701
67 Ga0466734_001673 3300042623 Bacteria 1003
68 Ga0466703_153851 3300042636 Bacteria 6342
69 Ga0466704_072182 3300042643 Bacteria 5034
70 Ga0466727_104013 3300042655 Bacteria 2447
71 Ga0466715_389672 3300042616 Bacteria 1471
72 Ga0466726_079336 3300042619 Bacteria 3089
73 Ga0466726_128613 3300042619 Bacteria 4263
74 Ga0466728_040018 3300042620 Unclassified 3668
75 JGI24698J34947_10156135 3300002449 Bacteria 941
76 JGI24699J35502_10810331 3300002509 Bacteria 893
77 JGI24699J35502_11036430 3300002509 Unclassified 1544
78 Ga0466705_327501 3300042612 Bacteria 3286
79 Ga0466707_024193 3300042601 Bacteria 2196
80 Ga0466707_371838 3300042601 Bacteria 1829
81 Ga0466692_001349 3300042591 Unclassified 17229
82 Ga0466691_177844 3300042593 Bacteria 8097
83 Ga0466709_268346 3300042648 Bacteria 3006
84 Ga0466727_209894 3300042655 Bacteria 1100
85 Ga0466711_277003 3300042615 Bacteria 1522
86 Ga0466715_313234 3300042616 Bacteria 5306
87 Ga0466715_588110 3300042616 Bacteria 16163
88 Ga0466723_004586 3300042618 Bacteria 72614
89 Ga0466723_035407 3300042618 Bacteria 3347
90 Ga0466728_178999 3300042620 Bacteria 5641
91 Ga0466729_150966 3300042621 Bacteria 3976
92 Ga0466705_358487 3300042612 Bacteria 1148
93 Ga0466722_119114 3300042609 Bacteria 1688
94 Ga0466691_080750 3300042593 Bacteria 1452
95 Ga0466703_183633 3300042636 Bacteria 9339
96 Ga0466709_324462 3300042648 Bacteria 2930
97 Ga0466727_178909 3300042655 Bacteria 2258
98 Ga0466705_424430 3300042612 Unclassified 1468
99 Ga0466715_330349 3300042616 Bacteria 1192
100 Ga0466715_361880 3300042616 Bacteria 6710
101 Ga0466728_029885 3300042620 Bacteria 2242
102 Ga0466728_083463 3300042620 Bacteria 1629
103 Ga0466728_179973 3300042620 Bacteria 5672
104 Ga0466728_327666 3300042620 Bacteria 2660
105 Ga0466728_355066 3300042620 Bacteria 6492
106 JGI24698J34947_10154116 3300002449 Unclassified 950
107 JGI24702J35022_10009138 3300002462 Bacteria 5579

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125689 2781426784 162
2 3300002449 JGI24698J34947_10020660 JGI24698J34947_100206602 171
3 3300002449 JGI24698J34947_10156135 JGI24698J34947_101561352 172
4 3300002449 JGI24698J34947_10082969 JGI24698J34947_100829692 173
5 3300042635 Ga0466702_405472 Ga0466702_405472_527_1066 179
6 3300042609 Ga0466722_119114 Ga0466722_119114_807_1361 184
7 3300042614 Ga0466712_052492 Ga0466712_052492_843_1397 184
8 3300042615 Ga0466711_448853 Ga0466711_448853_1043_1597 184
9 3300042620 Ga0466728_083463 Ga0466728_083463_208_762 184
10 3300042623 Ga0466734_001673 Ga0466734_001673_142_696 184
11 3300042643 Ga0466704_104121 Ga0466704_104121_385_939 184
12 3300042643 Ga0466704_250391 Ga0466704_250391_516_1070 184
13 3300002449 JGI24698J34947_10154116 JGI24698J34947_101541162 185
14 3300002462 JGI24702J35022_10107981 JGI24702J35022_101079812 185
15 3300002507 JGI24697J35500_11274490 JGI24697J35500_112744902 185
16 3300002509 JGI24699J35502_10810331 JGI24699J35502_108103312 185
17 3300002509 JGI24699J35502_10866751 JGI24699J35502_108667512 185
18 3300005083 Ga0068305_10214534 Ga0068305_102145343 185
19 3300042601 Ga0466707_024193 Ga0466707_024193_1362_1919 185
20 3300042616 Ga0466715_029050 Ga0466715_029050_414_971 185
21 3300042619 Ga0466726_128613 Ga0466726_128613_1953_2510 185
22 3300042619 Ga0466726_433005 Ga0466726_433005_2477_3034 185
23 3300042621 Ga0466729_165676 Ga0466729_165676_518_1075 185
24 3300042655 Ga0466727_104013 Ga0466727_104013_431_988 185
25 3300042593 Ga0466691_101000 Ga0466691_101000_7570_8130 186
26 3300042602 Ga0466713_056591 Ga0466713_056591_1107_1667 186
27 3300042614 Ga0466712_088820 Ga0466712_088820_464_1024 186
28 3300042616 Ga0466715_588110 Ga0466715_588110_8594_9154 186
29 3300042618 Ga0466723_004586 Ga0466723_004586_12712_13272 186
30 3300042618 Ga0466723_179250 Ga0466723_179250_7223_7783 186
31 3300042655 Ga0466727_209894 Ga0466727_209894_180_740 186
32 3300042593 Ga0466691_031131 Ga0466691_031131_7362_7925 187
33 3300042596 Ga0466696_239211 Ga0466696_239211_247_810 187
34 3300042615 Ga0466711_141081 Ga0466711_141081_1173_1736 187
35 3300042616 Ga0466715_275550 Ga0466715_275550_206_769 187
36 3300042620 Ga0466728_355066 Ga0466728_355066_4950_5513 187
37 3300042621 Ga0466729_239241 Ga0466729_239241_623_1186 187
38 3300042643 Ga0466704_015084 Ga0466704_015084_88_651 187
39 3300042590 Ga0466690_108394 Ga0466690_108394_1007_1573 188
40 3300042590 Ga0466690_336160 Ga0466690_336160_551_1117 188
41 3300042593 Ga0466691_065156 Ga0466691_065156_2745_3311 188
42 3300042593 Ga0466691_080750 Ga0466691_080750_465_1031 188
43 3300042593 Ga0466691_217802 Ga0466691_217802_411_977 188
44 3300042601 Ga0466707_023635 Ga0466707_023635_1618_2184 188
45 3300042601 Ga0466707_304359 Ga0466707_304359_768_1334 188
46 3300042605 Ga0466716_183019 Ga0466716_183019_666_1232 188
47 3300042606 Ga0466719_103894 Ga0466719_103894_184_750 188
48 3300042606 Ga0466719_152734 Ga0466719_152734_950_1516 188
49 3300042606 Ga0466719_181010 Ga0466719_181010_4478_5044 188
50 3300042616 Ga0466715_207235 Ga0466715_207235_84_650 188
51 3300042616 Ga0466715_261338 Ga0466715_261338_506_1072 188
52 3300042616 Ga0466715_330349 Ga0466715_330349_302_868 188
53 3300042616 Ga0466715_389672 Ga0466715_389672_836_1402 188
54 3300042616 Ga0466715_503867 Ga0466715_503867_194_760 188
55 3300042618 Ga0466723_035407 Ga0466723_035407_2109_2675 188
56 3300042618 Ga0466723_094133 Ga0466723_094133_29_595 188
57 3300042618 Ga0466723_147133 Ga0466723_147133_925_1491 188
58 3300042618 Ga0466723_186007 Ga0466723_186007_81_647 188
59 3300042619 Ga0466726_008970 Ga0466726_008970_1445_2011 188
60 3300042619 Ga0466726_020528 Ga0466726_020528_3822_4388 188
61 3300042619 Ga0466726_063690 Ga0466726_063690_1226_1792 188
62 3300042619 Ga0466726_079336 Ga0466726_079336_1386_1952 188
63 3300042620 Ga0466728_178999 Ga0466728_178999_3887_4453 188
64 3300042620 Ga0466728_179973 Ga0466728_179973_788_1354 188
65 3300042620 Ga0466728_327666 Ga0466728_327666_634_1200 188
66 3300042643 Ga0466704_072182 Ga0466704_072182_961_1527 188
67 3300042648 Ga0466709_324462 Ga0466709_324462_1276_1842 188
68 3300042655 Ga0466727_018809 Ga0466727_018809_2138_2704 188
69 3300042655 Ga0466727_172020 Ga0466727_172020_1367_1933 188
70 3300042655 Ga0466727_178909 Ga0466727_178909_1257_1823 188
71 3300042606 Ga0466719_151859 Ga0466719_151859_207_776 189
72 3300042612 Ga0466705_180006 Ga0466705_180006_6396_6965 189
73 3300042615 Ga0466711_277003 Ga0466711_277003_34_603 189
74 3300042616 Ga0466715_040587 Ga0466715_040587_687_1256 189
75 3300042616 Ga0466715_327506 Ga0466715_327506_159_728 189
76 3300042616 Ga0466715_361880 Ga0466715_361880_2302_2871 189
77 3300042621 Ga0466729_150966 Ga0466729_150966_204_773 189
78 3300042636 Ga0466703_183633 Ga0466703_183633_2902_3471 189
79 3300042652 Ga0466708_367907 Ga0466708_367907_579_1148 189
80 iso_pr_bacteria 2778260940 2778357315 189
81 3300002449 JGI24698J34947_10004291 JGI24698J34947_100042911 190
82 3300002449 JGI24698J34947_10113620 JGI24698J34947_101136202 190
83 3300002509 JGI24699J35502_11036430 JGI24699J35502_110364302 190
84 3300042601 Ga0466707_371838 Ga0466707_371838_324_896 190
85 3300042614 Ga0466712_113651 Ga0466712_113651_125_697 190
86 3300042612 Ga0466705_327501 Ga0466705_327501_2079_2654 191
87 3300042618 Ga0466723_050188 Ga0466723_050188_7110_7685 191
88 3300042648 Ga0466709_003678 Ga0466709_003678_5448_6023 191
89 3300042648 Ga0466709_214076 Ga0466709_214076_41_616 191
90 3300042620 Ga0466728_029885 Ga0466728_029885_71_649 192
91 3300042620 Ga0466728_040018 Ga0466728_040018_2221_2799 192
92 3300042591 Ga0466692_001349 Ga0466692_001349_10148_10732 194
93 3300042609 Ga0466722_168594 Ga0466722_168594_1506_2132 194
94 3300042619 Ga0466726_027505 Ga0466726_027505_367_951 194
95 3300042636 Ga0466703_153851 Ga0466703_153851_600_1205 194
96 3300042612 Ga0466705_424430 Ga0466705_424430_191_778 195
97 3300042643 Ga0466704_494350 Ga0466704_494350_561_1148 195
98 3300042648 Ga0466709_103948 Ga0466709_103948_809_1396 195
99 3300042602 Ga0466713_127166 Ga0466713_127166_31_630 199
100 3300042616 Ga0466715_313234 Ga0466715_313234_1550_2149 199
101 3300042618 Ga0466723_194322 Ga0466723_194322_3988_4587 199
102 3300002462 JGI24702J35022_10009138 JGI24702J35022_100091383 200
103 3300042593 Ga0466691_177844 Ga0466691_177844_758_1360 200
104 3300042612 Ga0466705_358487 Ga0466705_358487_166_771 201
105 3300042620 Ga0466728_036315 Ga0466728_036315_226_831 201
106 3300042652 Ga0466708_124717 Ga0466708_124717_4869_5483 204
107 3300042615 Ga0466711_161966 Ga0466711_161966_797_1417 206
108 3300042648 Ga0466709_268346 Ga0466709_268346_2246_2869 207
109 3300042616 Ga0466715_013332 Ga0466715_013332_2347_3039 230

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12682 Flavodoxin_4 Flavodoxin 73 224 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF12682 GO:0010181 FMN binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.68 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.