Protein Family IF07577

Metagenome Isolate
157 Members
84 Samples
132 Scaffolds
238.25 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_471661|Ga0466711_471661_720_1496
Length
258 aa
Sequence
MRILIWNNGVTTMLQGQIALVTGASRGIGKAVALELARLGATVVGTATSASGAEDISAYLKAAGAQGRGAALEVRDQAQVDELMAVIEKEFGGIGILVNNAGITRDNLAMRMKDDELDAVINTNLKAVFSLSRAVMRGMMKARGGRIINITSVVGHSGNAGQANYCAAKAGVTGLTRALARELGSRNVTVNCVAPGMIDTDMTKALPEALKVSLLKNIPLARLGAPEDVAAAVAFLASPGAAYVSGATLHVNGGMYMD

📊 Sample Types

Isolate 15.9%
Metagenome 84.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 25.6%
Termitidae 20.7%
Kalotermitidae 14.6%
Formicidae 11.0%
Culicidae 6.1%
Elmidae 6.1%
Armadillidiidae 3.7%
Rhinotermitidae 3.7%
Termopsidae 3.7%
Passalidae 2.4%
Hodotermitidae 1.2%
Drosophilidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 148
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
2 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
3 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
4 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
5 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
6 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
11 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
12 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
13 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
14 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
15 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
19 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
20 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
21 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
22 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
23 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
24 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
25 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
26 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
31 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
34 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
35 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
36 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
37 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
41 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
42 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
45 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
48 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
49 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
50 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
51 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
52 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
53 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
56 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
57 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
58 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
59 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
60 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
61 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
62 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
63 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
64 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
65 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
66 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
67 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
68 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
69 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
70 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
71 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
72 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
73 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
74 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
75 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
76 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
77 2603880170 Burkholderiales A2 Isolate Unclassified
78 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
79 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
80 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
81 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
82 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
83 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
84 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10001850 3300010882 Bacteria 26748
2 Ga0160472_101896 3300012839 Bacteria 5295
3 Ga0160435_1016193 3300012857 Unclassified 1411
4 Ga0466657_100266 3300042582 Bacteria 22203
5 Ga0466690_413077 3300042590 Bacteria 6607
6 Ga0466715_251362 3300042616 Bacteria 11878
7 Ga0466728_067798 3300042620 Bacteria 15989
8 Ga0466701_061233 3300042598 Bacteria 8429
9 Ga0466707_111478 3300042601 Bacteria 11891
10 Ga0466717_072676 3300042604 Bacteria 7069
11 Ga0466735_097805 3300042624 Bacteria 3468
12 CVPL005L_10021531 3300002938 Unclassified 3126
13 Ga0102737_1001177 3300007142 Bacteria 7608
14 Ga0123357_10000046 3300009784 Bacteria 99884
15 Ga0160441_106275 3300012825 Unclassified 1686
16 Ga0466692_031907 3300042591 Bacteria 15316
17 Ga0466710_080652 3300042613 Bacteria 9516
18 Ga0466734_104426 3300042623 Bacteria 19157
19 Ga0466708_219741 3300042652 Bacteria 4500
20 IMNBL1DRAFT_c0000645 3300000062 Bacteria 27923
21 Ga0103261_1000092 3300007083 Bacteria 21234
22 Ga0466733_175091 3300042659 Bacteria 58462
23 Ga0123355_10208954 3300009826 Bacteria 2834
24 Ga0123354_10000003 3300010882 Bacteria 303062
25 Ga0466691_038231 3300042593 Bacteria 51865
26 Ga0466710_241131 3300042613 Bacteria 1272
27 Ga0466723_100869 3300042618 Bacteria 18431
28 Ga0466723_204571 3300042618 Bacteria 23149
29 Ga0466729_078583 3300042621 Bacteria 10189
30 Ga0466707_310561 3300042601 Bacteria 13184
31 Ga0466722_136243 3300042609 Bacteria 2295
32 Ga0466722_219493 3300042609 Bacteria 9476
33 Ga0466727_124349 3300042655 Bacteria 22570
34 Ga0466727_321238 3300042655 Bacteria 5034
35 CVPL005L_10002222 3300002938 Bacteria 22318
36 Ga0102737_1000178 3300007142 Bacteria 21470
37 Ga0102737_1012415 3300007142 Unclassified 1393
38 Ga0103264_1000007 3300007188 Bacteria 144836
39 Ga0466697_278942 3300042611 Bacteria 3790
40 Ga0466657_110779 3300042582 Bacteria 3711
41 Ga0466690_227357 3300042590 Bacteria 66582
42 Ga0466701_008099 3300042598 Bacteria 5996
43 Ga0466710_350583 3300042613 Bacteria 1067
44 Ga0466715_569061 3300042616 Bacteria 12213
45 Ga0466719_093085 3300042606 Bacteria 3557
46 Ga0466719_368611 3300042606 Bacteria 7148
47 Ga0466734_162578 3300042623 Bacteria 6808
48 Ga0466709_294347 3300042648 Bacteria 12749
49 Ga0466709_396456 3300042648 Bacteria 3124
50 IMNBGM34_c000096 3300000036 Bacteria 25246
51 Ga0103260_1000165 3300007139 Bacteria 14864
52 Ga0102740_1001241 3300007140 Bacteria 6594
53 Ga0123356_10575050 3300010049 Bacteria 1290
54 Ga0123354_10011033 3300010882 Bacteria 13940
55 Ga0160454_100009 3300012798 Bacteria 406749
56 Ga0160441_100074 3300012825 Bacteria 121896
57 Ga0160460_106933 3300012845 Bacteria 1522
58 Ga0466657_010114 3300042582 Bacteria 4381
59 Ga0466657_340854 3300042582 Bacteria 25164
60 Ga0466695_100872 3300042595 Bacteria 1500
61 Ga0466696_043847 3300042596 Bacteria 2296
62 Ga0466710_243318 3300042613 Bacteria 10895
63 Ga0466726_155620 3300042619 Bacteria 7754
64 Ga0466726_352297 3300042619 Bacteria 3826
65 Ga0466717_100792 3300042604 Bacteria 4611
66 Ga0466725_419604 3300042654 Bacteria 30090
67 JGI24702J35022_10017983 3300002462 Bacteria 3858
68 CVPL010W_10000809 3300002931 Bacteria 35405
69 Ga0103260_1000175 3300007139 Unclassified 14156
70 Ga0102737_1001543 3300007142 Bacteria 6325
71 Ga0103264_1000114 3300007188 Bacteria 51929
72 Ga0103264_1000770 3300007188 Bacteria 15269
73 Ga0103268_1002216 3300007192 Bacteria 4413
74 Ga0123356_10013626 3300010049 Bacteria 7837
75 Ga0160456_100106 3300012820 Bacteria 94170
76 Ga0160467_100035 3300012829 Bacteria 221416
77 Ga0466657_022763 3300042582 Bacteria 4140
78 Ga0466692_114364 3300042591 Bacteria 16144
79 Ga0466692_150552 3300042591 Bacteria 36536
80 Ga0466696_046004 3300042596 Bacteria 8611
81 Ga0466711_250187 3300042615 Bacteria 9369
82 Ga0466711_471661 3300042615 Bacteria 2644
83 Ga0466715_588037 3300042616 Bacteria 7247
84 Ga0466700_481004 3300042600 Bacteria 4960
85 Ga0466707_157215 3300042601 Bacteria 1000
86 Ga0466734_043508 3300042623 Bacteria 1516
87 Ga0466703_258811 3300042636 Bacteria 16059
88 Ga0466709_171677 3300042648 Bacteria 43255
89 Ga0466724_01957 3300042649 Bacteria 6069
90 Ga0466725_367569 3300042654 Bacteria 1375
91 JGI24702J35022_10002832 3300002462 Bacteria 10504
92 CVPL010W_10037065 3300002931 Unclassified 1597
93 CVPL005W_1000062 3300002934 Bacteria 41932
94 Ga0466697_205125 3300042611 Bacteria 1072
95 Ga0466705_084270 3300042612 Unclassified 7568
96 Ga0466733_216402 3300042659 Bacteria 2155
97 Ga0123356_10015174 3300010049 Bacteria 7385
98 Ga0123356_10232171 3300010049 Bacteria 1910
99 Ga0160447_108953 3300012849 Bacteria 2338
100 Ga0466657_010966 3300042582 Bacteria 29326
101 Ga0466691_028446 3300042593 Bacteria 21785
102 Ga0466696_441724 3300042596 Bacteria 3214
103 Ga0466715_357484 3300042616 Bacteria 57051
104 Ga0466718_094139 3300042617 Bacteria 4173
105 Ga0466723_262633 3300042618 Bacteria 7364
106 Ga0466728_002422 3300042620 Bacteria 3344
107 Ga0466706_269808 3300042599 Bacteria 6250
108 Ga0466734_097305 3300042623 Bacteria 4866
109 Ga0466703_177806 3300042636 Bacteria 5090
110 Ga0466709_054053 3300042648 Bacteria 3377
111 Ga0466725_061032 3300042654 Bacteria 120083
112 Ga0466725_187893 3300042654 Bacteria 24541
113 CVPL010W_10001712 3300002931 Bacteria 26028
114 Ga0104048_1173746 3300007143 Bacteria 1190
115 Ga0160471_100123 3300012812 Unclassified 32804
116 Ga0160433_103705 3300012846 Unclassified 2636
117 Ga0466657_018193 3300042582 Bacteria 1279
118 Ga0466691_181819 3300042593 Bacteria 7497
119 Ga0466710_108458 3300042613 Bacteria 43285
120 Ga0466710_229378 3300042613 Bacteria 8079
121 Ga0466710_362546 3300042613 Bacteria 89580
122 Ga0466715_082437 3300042616 Bacteria 6986
123 Ga0466715_621674 3300042616 Bacteria 2480
124 Ga0466729_010610 3300042621 Bacteria 4836
125 Ga0466729_055672 3300042621 Bacteria 8615
126 Ga0466707_349450 3300042601 Bacteria 9793
127 Ga0466719_547569 3300042606 Bacteria 2876
128 Ga0466722_231705 3300042609 Bacteria 14554
129 Ga0466725_275200 3300042654 Bacteria 66856
130 Ga0466725_440977 3300042654 Bacteria 1778
131 Ga0103264_1000056 3300007188 Bacteria 65902
132 Ga0123357_10000219 3300009784 Bacteria 54155

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_150552 Ga0466692_150552_11302_12045 207
2 3300042616 Ga0466715_251362 Ga0466715_251362_4250_4996 208
3 3300000036 IMNBGM34_c000096 IMNBGM34_0000962 213
4 3300002931 CVPL010W_10000809 CVPL010W_1000080930 215
5 3300042616 Ga0466715_569061 Ga0466715_569061_4668_5429 215
6 3300042609 Ga0466722_136243 Ga0466722_136243_1314_2057 217
7 3300042609 Ga0466722_219493 Ga0466722_219493_5813_6556 217
8 3300042601 Ga0466707_111478 Ga0466707_111478_6581_7330 219
9 3300042601 Ga0466707_157215 Ga0466707_157215_45_794 219
10 3300042601 Ga0466707_349450 Ga0466707_349450_145_894 219
11 3300042648 Ga0466709_294347 Ga0466709_294347_9440_10189 219
12 3300042616 Ga0466715_082437 Ga0466715_082437_4012_4755 220
13 3300042616 Ga0466715_588037 Ga0466715_588037_742_1491 220
14 3300042648 Ga0466709_171677 Ga0466709_171677_38011_38760 220
15 3300042590 Ga0466690_227357 Ga0466690_227357_9108_9857 221
16 3300012798 Ga0160454_100009 Ga0160454_10000983 222
17 3300012825 Ga0160441_106275 Ga0160441_1062751 222
18 3300012845 Ga0160460_106933 Ga0160460_1069332 222
19 3300042618 Ga0466723_262633 Ga0466723_262633_2692_3441 222
20 3300042623 Ga0466734_043508 Ga0466734_043508_173_919 222
21 3300007142 Ga0102737_1001543 Ga0102737_10015434 223
22 3300042612 Ga0466705_084270 Ga0466705_084270_2469_3212 223
23 3300042615 Ga0466711_250187 Ga0466711_250187_6505_7248 223
24 3300042618 Ga0466723_204571 Ga0466723_204571_7323_8066 223
25 3300042648 Ga0466709_054053 Ga0466709_054053_1236_1979 223
26 3300007142 Ga0102737_1012415 Ga0102737_10124152 224
27 3300042616 Ga0466715_621674 Ga0466715_621674_1270_2013 224
28 3300042654 Ga0466725_061032 Ga0466725_061032_22351_23091 224
29 3300042655 Ga0466727_321238 Ga0466727_321238_210_953 224
30 3300042582 Ga0466657_010966 Ga0466657_010966_7126_7875 225
31 3300042582 Ga0466657_110779 Ga0466657_110779_2877_3626 225
32 3300042590 Ga0466690_413077 Ga0466690_413077_1232_1975 225
33 3300042593 Ga0466691_028446 Ga0466691_028446_5991_6740 225
34 3300042609 Ga0466722_231705 Ga0466722_231705_1645_2394 225
35 3300042613 Ga0466710_108458 Ga0466710_108458_7055_7804 225
36 3300042621 Ga0466729_010610 Ga0466729_010610_2608_3357 225
37 3300042655 Ga0466727_124349 Ga0466727_124349_3372_4121 225
38 3300042659 Ga0466733_175091 Ga0466733_175091_27203_27952 225
39 3300002462 JGI24702J35022_10017983 JGI24702J35022_100179835 226
40 3300007142 Ga0102737_1001177 Ga0102737_10011772 226
41 3300012820 Ga0160456_100106 Ga0160456_10010614 226
42 3300012825 Ga0160441_100074 Ga0160441_10007475 226
43 3300012829 Ga0160467_100035 Ga0160467_10003554 226
44 3300012846 Ga0160433_103705 Ga0160433_1037052 226
45 3300042591 Ga0466692_031907 Ga0466692_031907_3167_3847 226
46 3300042591 Ga0466692_114364 Ga0466692_114364_11201_11950 226
47 3300002931 CVPL010W_10037065 CVPL010W_100370653 227
48 3300002938 CVPL005L_10002222 CVPL005L_1000222218 227
49 3300042600 Ga0466700_481004 Ga0466700_481004_2145_2894 227
50 3300042604 Ga0466717_072676 Ga0466717_072676_5326_6081 227
51 3300042604 Ga0466717_100792 Ga0466717_100792_2862_3617 227
52 3300042617 Ga0466718_094139 Ga0466718_094139_2704_3459 227
53 3300042623 Ga0466734_097305 Ga0466734_097305_3911_4666 227
54 3300042654 Ga0466725_419604 Ga0466725_419604_1878_2618 227
55 3300002462 JGI24702J35022_10002832 JGI24702J35022_100028328 228
56 3300009784 Ga0123357_10000219 Ga0123357_1000021947 228
57 3300042613 Ga0466710_350583 Ga0466710_350583_213_953 228
58 3300042619 Ga0466726_155620 Ga0466726_155620_4429_5172 228
59 3300010882 Ga0123354_10000003 Ga0123354_10000003203 229
60 3300002931 CVPL010W_10001712 CVPL010W_100017125 230
61 3300002938 CVPL005L_10021531 CVPL005L_100215315 231
62 3300007188 Ga0103264_1000770 Ga0103264_10007706 232
63 3300007188 Ga0103264_1000114 Ga0103264_100011410 234
64 3300000062 IMNBL1DRAFT_c0000645 IMNBL1DRAFT_000064521 235
65 3300042619 Ga0466726_352297 Ga0466726_352297_672_1430 237
66 3300042606 Ga0466719_547569 Ga0466719_547569_774_1517 238
67 3300042648 Ga0466709_396456 Ga0466709_396456_2284_3027 238
68 3300042659 Ga0466733_216402 Ga0466733_216402_30_785 239
69 3300042593 Ga0466691_181819 Ga0466691_181819_2552_3295 241
70 3300042601 Ga0466707_310561 Ga0466707_310561_5338_6099 242
71 3300042624 Ga0466735_097805 Ga0466735_097805_1242_2003 242
72 3300012812 Ga0160471_100123 Ga0160471_10012325 245
73 3300012857 Ga0160435_1016193 Ga0160435_10161931 245
74 iso_pr_bacteria 2864859030 2864863153 245
75 iso_pr_bacteria 2864914039 2864918058 245
76 iso_pr_bacteria 2864988360 2864992199 245
77 3300042582 Ga0466657_022763 Ga0466657_022763_2822_3562 246
78 3300042582 Ga0466657_340854 Ga0466657_340854_24359_25099 246
79 3300042593 Ga0466691_038231 Ga0466691_038231_45468_46208 246
80 3300042606 Ga0466719_368611 Ga0466719_368611_705_1445 246
81 3300042613 Ga0466710_241131 Ga0466710_241131_157_897 246
82 3300042613 Ga0466710_362546 Ga0466710_362546_53944_54684 246
83 3300042618 Ga0466723_100869 Ga0466723_100869_2738_3478 246
84 3300042620 Ga0466728_067798 Ga0466728_067798_6853_7593 246
85 3300042623 Ga0466734_162578 Ga0466734_162578_3967_4707 246
86 3300042636 Ga0466703_258811 Ga0466703_258811_9219_9959 246
87 iso_pr_bacteria 2820084079 2820086135 246
88 iso_pr_bacteria 2820086750 2820087766 246
89 iso_pr_bacteria 2820157249 2820159441 246
90 3300007143 Ga0104048_1173746 Ga0104048_11737462 247
91 3300010882 Ga0123354_10011033 Ga0123354_1001103310 247
92 3300042596 Ga0466696_043847 Ga0466696_043847_917_1660 247
93 3300042596 Ga0466696_046004 Ga0466696_046004_6070_6813 247
94 3300042606 Ga0466719_093085 Ga0466719_093085_2549_3292 247
95 3300042613 Ga0466710_229378 Ga0466710_229378_4673_5416 247
96 3300042620 Ga0466728_002422 Ga0466728_002422_2441_3184 247
97 3300042621 Ga0466729_055672 Ga0466729_055672_1476_2219 247
98 3300042621 Ga0466729_078583 Ga0466729_078583_369_1112 247
99 3300042623 Ga0466734_104426 Ga0466734_104426_7290_8033 247
100 3300042636 Ga0466703_177806 Ga0466703_177806_4160_4903 247
101 3300042652 Ga0466708_219741 Ga0466708_219741_22_765 247
102 3300042654 Ga0466725_440977 Ga0466725_440977_144_887 247
103 iso_pr_bacteria 2603880170 2606027695 247
104 iso_pr_bacteria 2687453742 2689987752 247
105 iso_pr_bacteria 2687453753 2690038421 247
106 iso_pr_bacteria 2848339753 2848341307 247
107 iso_pr_bacteria 2864826666 2864828129 247
108 iso_pr_bacteria 2864968865 2864969776 247
109 3300007083 Ga0103261_1000092 Ga0103261_100009215 248
110 3300007139 Ga0103260_1000175 Ga0103260_100017513 248
111 3300007140 Ga0102740_1001241 Ga0102740_10012412 248
112 3300007142 Ga0102737_1000178 Ga0102737_10001787 248
113 3300007188 Ga0103264_1000007 Ga0103264_1000007113 248
114 3300007188 Ga0103264_1000056 Ga0103264_100005657 248
115 3300007192 Ga0103268_1002216 Ga0103268_10022164 248
116 3300012839 Ga0160472_101896 Ga0160472_1018967 248
117 3300012849 Ga0160447_108953 Ga0160447_1089532 248
118 3300042595 Ga0466695_100872 Ga0466695_100872_712_1458 248
119 iso_pr_bacteria 2820123897 2820126615 248
120 3300002934 CVPL005W_1000062 CVPL005W_100006214 249
121 3300042582 Ga0466657_010114 Ga0466657_010114_355_1104 249
122 3300042582 Ga0466657_018193 Ga0466657_018193_141_890 249
123 3300042654 Ga0466725_275200 Ga0466725_275200_50447_51196 249
124 iso_pr_bacteria 2820042117 2820043848 249
125 iso_pr_bacteria 2820065746 2820066648 249
126 iso_pr_bacteria 2820121232 2820121571 249
127 iso_pr_bacteria 2820131053 2820131518 249
128 3300007139 Ga0103260_1000165 Ga0103260_10001654 250
129 3300010049 Ga0123356_10015174 Ga0123356_100151743 250
130 3300010882 Ga0123354_10001850 Ga0123354_100018507 250
131 3300042582 Ga0466657_100266 Ga0466657_100266_16230_16982 250
132 3300042611 Ga0466697_278942 Ga0466697_278942_1552_2304 250
133 3300042616 Ga0466715_357484 Ga0466715_357484_16712_17464 250
134 iso_pr_bacteria 2820103659 2820103886 250
135 3300009784 Ga0123357_10000046 Ga0123357_1000004652 251
136 3300010049 Ga0123356_10232171 Ga0123356_102321712 251
137 3300042596 Ga0466696_441724 Ga0466696_441724_371_1126 251
138 3300042598 Ga0466701_061233 Ga0466701_061233_6834_7589 251
139 3300042599 Ga0466706_269808 Ga0466706_269808_4265_5020 251
140 3300042611 Ga0466697_205125 Ga0466697_205125_181_936 251
141 3300042613 Ga0466710_243318 Ga0466710_243318_3052_3807 251
142 3300042649 Ga0466724_01957 Ga0466724_01957_4977_5732 251
143 3300042654 Ga0466725_187893 Ga0466725_187893_537_1292 251
144 3300042654 Ga0466725_367569 Ga0466725_367569_205_960 251
145 iso_pr_bacteria 2820071837 2820072181 251
146 iso_pr_bacteria 2820077244 2820077752 251
147 iso_pr_bacteria 2820089333 2820090048 251
148 iso_pr_bacteria 2820161938 2820162789 251
149 iso_pr_bacteria 2820164216 2820165885 251
150 iso_pr_bacteria 2891720358 2891720742 251
151 3300009826 Ga0123355_10208954 Ga0123355_102089542 252
152 3300010049 Ga0123356_10013626 Ga0123356_100136268 252
153 3300010049 Ga0123356_10575050 Ga0123356_105750502 252
154 iso_pr_bacteria 2820050117 2820051446 253
155 3300042613 Ga0466710_080652 Ga0466710_080652_7795_8565 256
156 3300042615 Ga0466711_471661 Ga0466711_471661_720_1496 258
157 3300042598 Ga0466701_008099 Ga0466701_008099_329_1177 282

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 17 208 0.98
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 23 255 0.97
PF08659 KR KR domain 20 191 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.