Protein Family IF07574
Metagenome
Metatranscriptome
Isolate
156
Members
55
Samples
153
Scaffolds
92.92
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_453998|Ga0466711_453998_1232_1537
- Length
- 101 aa
- Sequence
- VIICKVLGNVWATKKDEKLSGHKLLVVRTIGQEDSETFVAADNVGAGIGEDVLVSKGSVARNSLGQKDSPIDAVVVGIIDSLEVDGALLGQGPNPEESEEE
Sample Types
Isolate
1.9%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Kalotermitidae
27.5%
Unclassified
9.8%
Termopsidae
5.9%
Rhinotermitidae
5.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 5 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 9 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 27 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 42 | 3300021232 | Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA | Metatranscriptome | |
| 43 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_335356 | 3300042612 | Bacteria | 7475 |
| 2 | Ga0072941_1240704 | 3300005201 | Bacteria | 699 |
| 3 | Ga0123356_10003912 | 3300010049 | Bacteria | 15506 |
| 4 | Ga0123356_10021227 | 3300010049 | Bacteria | 6133 |
| 5 | Ga0123356_10431002 | 3300010049 | Bacteria | 1463 |
| 6 | Ga0123353_10056265 | 3300010167 | Bacteria | 6295 |
| 7 | Ga0466694_359682 | 3300042594 | Unclassified | 1924 |
| 8 | Ga0466715_332812 | 3300042616 | Bacteria | 62212 |
| 9 | Ga0466726_183478 | 3300042619 | Bacteria | 4832 |
| 10 | Ga0466700_027911 | 3300042600 | Bacteria | 2546 |
| 11 | Ga0466707_422503 | 3300042601 | Bacteria | 2546 |
| 12 | Ga0466714_020610 | 3300042603 | Bacteria | 12324 |
| 13 | Ga0466722_092653 | 3300042609 | Bacteria | 6357 |
| 14 | Ga0466729_198692 | 3300042621 | Bacteria | 1817 |
| 15 | Ga0466703_017206 | 3300042636 | Bacteria | 2828 |
| 16 | Ga0466704_308427 | 3300042643 | Bacteria | 5334 |
| 17 | Ga0466704_349181 | 3300042643 | Bacteria | 24462 |
| 18 | Ga0466705_201063 | 3300042612 | Unclassified | 8252 |
| 19 | Ga0072941_1525134 | 3300005201 | Bacteria | 741 |
| 20 | Ga0123357_10001005 | 3300009784 | Bacteria | 28869 |
| 21 | Ga0123354_10176270 | 3300010882 | Bacteria | 2462 |
| 22 | Ga0123354_10494539 | 3300010882 | Bacteria | 958 |
| 23 | Ga0123354_10586566 | 3300010882 | Bacteria | 823 |
| 24 | Ga0466712_305246 | 3300042614 | Bacteria | 1466 |
| 25 | Ga0466715_198551 | 3300042616 | Bacteria | 1229 |
| 26 | Ga0466715_353133 | 3300042616 | Bacteria | 33453 |
| 27 | Ga0466718_017393 | 3300042617 | Bacteria | 2112 |
| 28 | Ga0466718_048556 | 3300042617 | Bacteria | 2886 |
| 29 | Ga0466718_053866 | 3300042617 | Bacteria | 3519 |
| 30 | Ga0466723_224102 | 3300042618 | Bacteria | 3343 |
| 31 | Ga0466726_114735 | 3300042619 | Bacteria | 1555 |
| 32 | Ga0466728_072095 | 3300042620 | Bacteria | 1878 |
| 33 | Ga0466716_335142 | 3300042605 | Unclassified | 18209 |
| 34 | Ga0466698_329613 | 3300042610 | Unclassified | 1506 |
| 35 | Ga0466698_400617 | 3300042610 | Bacteria | 1431 |
| 36 | Ga0466730_098132 | 3300042625 | Bacteria | 2669 |
| 37 | Ga0466703_097247 | 3300042636 | Bacteria | 7328 |
| 38 | Ga0466703_313337 | 3300042636 | Bacteria | 1353 |
| 39 | Ga0466727_131618 | 3300042655 | Bacteria | 1747 |
| 40 | Ga0466733_162555 | 3300042659 | Bacteria | 1089 |
| 41 | JGI24699J35502_11000967 | 3300002509 | Bacteria | 1353 |
| 42 | Ga0072941_1046791 | 3300005201 | Bacteria | 6703 |
| 43 | Ga0074263_137768 | 3300005485 | Unclassified | 864 |
| 44 | Ga0123357_10000620 | 3300009784 | Bacteria | 35228 |
| 45 | Ga0123357_10059632 | 3300009784 | Bacteria | 5120 |
| 46 | Ga0223676_1012140 | 3300021232 | Bacteria | 553 |
| 47 | Ga0264413_102031 | 3300024493 | Bacteria | 23746 |
| 48 | Ga0466692_178935 | 3300042591 | Bacteria | 17826 |
| 49 | Ga0466696_498014 | 3300042596 | Bacteria | 11596 |
| 50 | Ga0466705_467261 | 3300042612 | Bacteria | 40595 |
| 51 | Ga0466712_130623 | 3300042614 | Bacteria | 1932 |
| 52 | Ga0466711_024648 | 3300042615 | Bacteria | 7976 |
| 53 | Ga0466718_072199 | 3300042617 | Bacteria | 3189 |
| 54 | Ga0466718_122224 | 3300042617 | Unclassified | 1899 |
| 55 | Ga0466723_035369 | 3300042618 | Bacteria | 19204 |
| 56 | Ga0466723_109323 | 3300042618 | Bacteria | 3475 |
| 57 | Ga0466728_227597 | 3300042620 | Unclassified | 5934 |
| 58 | Ga0466728_279718 | 3300042620 | Bacteria | 2370 |
| 59 | Ga0466729_010101 | 3300042621 | Unclassified | 2213 |
| 60 | Ga0466729_106339 | 3300042621 | Bacteria | 41427 |
| 61 | Ga0466716_515854 | 3300042605 | Bacteria | 3427 |
| 62 | Ga0466719_153031 | 3300042606 | Bacteria | 1968 |
| 63 | Ga0466721_381539 | 3300042608 | Bacteria | 1338 |
| 64 | Ga0466703_151287 | 3300042636 | Bacteria | 9906 |
| 65 | Ga0466704_223283 | 3300042643 | Bacteria | 1521 |
| 66 | Ga0466708_111555 | 3300042652 | Unclassified | 5561 |
| 67 | Ga0466708_252186 | 3300042652 | Bacteria | 14225 |
| 68 | Ga0466705_291451 | 3300042612 | Bacteria | 3997 |
| 69 | JGI24695J34938_10164438 | 3300002450 | Unclassified | 913 |
| 70 | Ga0123356_10359051 | 3300010049 | Bacteria | 1583 |
| 71 | Ga0123353_10720492 | 3300010167 | Bacteria | 1395 |
| 72 | Ga0123353_12768697 | 3300010167 | Bacteria | 575 |
| 73 | Ga0466723_152203 | 3300042618 | Unclassified | 2746 |
| 74 | Ga0466726_156194 | 3300042619 | Bacteria | 6263 |
| 75 | Ga0466728_089830 | 3300042620 | Unclassified | 2385 |
| 76 | Ga0466700_065736 | 3300042600 | Unclassified | 1153 |
| 77 | Ga0466707_332266 | 3300042601 | Bacteria | 3055 |
| 78 | Ga0466698_494222 | 3300042610 | Bacteria | 3217 |
| 79 | Ga0466709_208078 | 3300042648 | Bacteria | 2460 |
| 80 | Ga0466727_141469 | 3300042655 | Bacteria | 1991 |
| 81 | Ga0123357_10216412 | 3300009784 | Bacteria | 2138 |
| 82 | Ga0123356_11003986 | 3300010049 | Bacteria | 1004 |
| 83 | Ga0415639_079234 | 3300038395 | Unclassified | 5268 |
| 84 | Ga0466691_216111 | 3300042593 | Bacteria | 5735 |
| 85 | Ga0466705_428371 | 3300042612 | Bacteria | 4947 |
| 86 | Ga0466718_041003 | 3300042617 | Bacteria | 24703 |
| 87 | Ga0466723_298779 | 3300042618 | Bacteria | 58508 |
| 88 | Ga0466700_030866 | 3300042600 | Bacteria | 5014 |
| 89 | Ga0466713_156645 | 3300042602 | Bacteria | 4814 |
| 90 | Ga0466714_064295 | 3300042603 | Bacteria | 3605 |
| 91 | Ga0466719_418869 | 3300042606 | Bacteria | 1058 |
| 92 | Ga0466704_296827 | 3300042643 | Bacteria | 36648 |
| 93 | Ga0466709_342021 | 3300042648 | Unclassified | 8307 |
| 94 | JGI24705J35276_12194554 | 3300002504 | Bacteria | 1513 |
| 95 | Ga0068302_10316095 | 3300005071 | Bacteria | 5254 |
| 96 | Ga0072940_1105090 | 3300005200 | Bacteria | 2296 |
| 97 | Ga0123357_10157372 | 3300009784 | Bacteria | 2736 |
| 98 | Ga0123356_10192597 | 3300010049 | Bacteria | 2071 |
| 99 | Ga0123356_10218134 | 3300010049 | Bacteria | 1962 |
| 100 | Ga0123356_10741868 | 3300010049 | Bacteria | 1152 |
| 101 | Ga0466690_012049 | 3300042590 | Bacteria | 2335 |
| 102 | Ga0466690_037309 | 3300042590 | Bacteria | 8375 |
| 103 | Ga0466699_187263 | 3300042597 | Bacteria | 4232 |
| 104 | Ga0466711_172672 | 3300042615 | Bacteria | 5399 |
| 105 | Ga0466711_453998 | 3300042615 | Bacteria | 2822 |
| 106 | Ga0466715_075345 | 3300042616 | Bacteria | 8230 |
| 107 | Ga0466723_010964 | 3300042618 | Bacteria | 19788 |
| 108 | Ga0466728_206166 | 3300042620 | Bacteria | 1792 |
| 109 | Ga0466728_225114 | 3300042620 | Bacteria | 13578 |
| 110 | Ga0466700_469984 | 3300042600 | Bacteria | 11930 |
| 111 | Ga0466713_008223 | 3300042602 | Bacteria | 1444 |
| 112 | Ga0466716_508278 | 3300042605 | Bacteria | 2765 |
| 113 | Ga0466722_011667 | 3300042609 | Bacteria | 11492 |
| 114 | Ga0466702_139598 | 3300042635 | Bacteria | 2679 |
| 115 | Ga0466703_017494 | 3300042636 | Bacteria | 9516 |
| 116 | Ga0466703_222051 | 3300042636 | Bacteria | 1175 |
| 117 | Ga0466708_429165 | 3300042652 | Bacteria | 2998 |
| 118 | JGI24699J35502_11049566 | 3300002509 | Bacteria | 1640 |
| 119 | JGI24699J35502_11134017 | 3300002509 | Bacteria | 24388 |
| 120 | Ga0123357_10104560 | 3300009784 | Bacteria | 3635 |
| 121 | Ga0123357_10121303 | 3300009784 | Bacteria | 3292 |
| 122 | Ga0123357_10369173 | 3300009784 | Bacteria | 1347 |
| 123 | Ga0123357_10409085 | 3300009784 | Bacteria | 1225 |
| 124 | Ga0123356_10011537 | 3300010049 | Bacteria | 8608 |
| 125 | Ga0123356_13319918 | 3300010049 | Bacteria | 559 |
| 126 | Ga0223674_1004893 | 3300021235 | Bacteria | 2708 |
| 127 | Ga0466693_213369 | 3300042592 | Bacteria | 2363 |
| 128 | Ga0466693_242731 | 3300042592 | Bacteria | 1137 |
| 129 | Ga0466696_031973 | 3300042596 | Bacteria | 3181 |
| 130 | Ga0466696_350962 | 3300042596 | Unclassified | 2996 |
| 131 | Ga0466723_014909 | 3300042618 | Bacteria | 24657 |
| 132 | Ga0466729_092439 | 3300042621 | Bacteria | 1773 |
| 133 | Ga0466706_233243 | 3300042599 | Bacteria | 5803 |
| 134 | Ga0466713_130188 | 3300042602 | Bacteria | 9287 |
| 135 | Ga0466714_014006 | 3300042603 | Bacteria | 2089 |
| 136 | Ga0466717_256529 | 3300042604 | Bacteria | 2325 |
| 137 | Ga0466698_433032 | 3300042610 | Bacteria | 5617 |
| 138 | Ga0466698_498699 | 3300042610 | Unclassified | 1476 |
| 139 | Ga0466727_136338 | 3300042655 | Bacteria | 3166 |
| 140 | Ga0466727_288606 | 3300042655 | Bacteria | 1040 |
| 141 | Ga0466705_203071 | 3300042612 | Unclassified | 14274 |
| 142 | JGI24698J34947_10090269 | 3300002449 | Bacteria | 1408 |
| 143 | Ga0123357_10552101 | 3300009784 | Bacteria | 918 |
| 144 | Ga0123356_12711378 | 3300010049 | Bacteria | 620 |
| 145 | Ga0123353_10558711 | 3300010167 | Unclassified | 1648 |
| 146 | Ga0123354_10253592 | 3300010882 | Bacteria | 1776 |
| 147 | Ga0466692_182024 | 3300042591 | Bacteria | 2888 |
| 148 | Ga0466691_088175 | 3300042593 | Unclassified | 11533 |
| 149 | Ga0466694_305401 | 3300042594 | Unclassified | 1039 |
| 150 | Ga0466695_200978 | 3300042595 | Bacteria | 1885 |
| 151 | Ga0466715_502939 | 3300042616 | Bacteria | 5160 |
| 152 | Ga0466728_108205 | 3300042620 | Bacteria | 9289 |
| 153 | Ga0466719_216205 | 3300042606 | Unclassified | 1144 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10558711 | Ga0123353_105587112 | 83 |
| 2 | 3300005200 | Ga0072940_1105090 | Ga0072940_11050904 | 85 |
| 3 | 3300042599 | Ga0466706_233243 | Ga0466706_233243_3988_4251 | 87 |
| 4 | 3300042617 | Ga0466718_053866 | Ga0466718_053866_2310_2573 | 87 |
| 5 | 3300042619 | Ga0466726_114735 | Ga0466726_114735_559_822 | 87 |
| 6 | 3300042619 | Ga0466726_183478 | Ga0466726_183478_2284_2547 | 87 |
| 7 | 3300042594 | Ga0466694_305401 | Ga0466694_305401_377_646 | 89 |
| 8 | 3300042604 | Ga0466717_256529 | Ga0466717_256529_155_424 | 89 |
| 9 | 3300042610 | Ga0466698_329613 | Ga0466698_329613_328_597 | 89 |
| 10 | 3300042610 | Ga0466698_400617 | Ga0466698_400617_867_1136 | 89 |
| 11 | 3300042610 | Ga0466698_494222 | Ga0466698_494222_1554_1823 | 89 |
| 12 | 3300042614 | Ga0466712_130623 | Ga0466712_130623_1468_1737 | 89 |
| 13 | 3300042617 | Ga0466718_048556 | Ga0466718_048556_1550_1819 | 89 |
| 14 | 3300042659 | Ga0466733_162555 | Ga0466733_162555_426_695 | 89 |
| 15 | 3300002449 | JGI24698J34947_10090269 | JGI24698J34947_100902692 | 90 |
| 16 | 3300021232 | Ga0223676_1012140 | Ga0223676_10121402 | 90 |
| 17 | 3300021235 | Ga0223674_1004893 | Ga0223674_10048935 | 90 |
| 18 | 3300024493 | Ga0264413_102031 | Ga0264413_10203112 | 90 |
| 19 | 3300042590 | Ga0466690_012049 | Ga0466690_012049_52_324 | 90 |
| 20 | 3300042590 | Ga0466690_037309 | Ga0466690_037309_870_1142 | 90 |
| 21 | 3300042591 | Ga0466692_178935 | Ga0466692_178935_6742_7014 | 90 |
| 22 | 3300042591 | Ga0466692_182024 | Ga0466692_182024_965_1237 | 90 |
| 23 | 3300042593 | Ga0466691_088175 | Ga0466691_088175_391_663 | 90 |
| 24 | 3300042593 | Ga0466691_216111 | Ga0466691_216111_490_762 | 90 |
| 25 | 3300042594 | Ga0466694_359682 | Ga0466694_359682_70_342 | 90 |
| 26 | 3300042595 | Ga0466695_200978 | Ga0466695_200978_1113_1385 | 90 |
| 27 | 3300042596 | Ga0466696_031973 | Ga0466696_031973_22_294 | 90 |
| 28 | 3300042596 | Ga0466696_350962 | Ga0466696_350962_22_294 | 90 |
| 29 | 3300042597 | Ga0466699_187263 | Ga0466699_187263_2727_2999 | 90 |
| 30 | 3300042600 | Ga0466700_027911 | Ga0466700_027911_416_688 | 90 |
| 31 | 3300042600 | Ga0466700_030866 | Ga0466700_030866_2159_2431 | 90 |
| 32 | 3300042600 | Ga0466700_065736 | Ga0466700_065736_438_710 | 90 |
| 33 | 3300042601 | Ga0466707_422503 | Ga0466707_422503_1781_2053 | 90 |
| 34 | 3300042605 | Ga0466716_335142 | Ga0466716_335142_10383_10655 | 90 |
| 35 | 3300042605 | Ga0466716_508278 | Ga0466716_508278_761_1033 | 90 |
| 36 | 3300042605 | Ga0466716_515854 | Ga0466716_515854_1315_1587 | 90 |
| 37 | 3300042606 | Ga0466719_153031 | Ga0466719_153031_1462_1734 | 90 |
| 38 | 3300042606 | Ga0466719_216205 | Ga0466719_216205_227_499 | 90 |
| 39 | 3300042608 | Ga0466721_381539 | Ga0466721_381539_790_1062 | 90 |
| 40 | 3300042609 | Ga0466722_011667 | Ga0466722_011667_7509_7781 | 90 |
| 41 | 3300042610 | Ga0466698_498699 | Ga0466698_498699_1027_1299 | 90 |
| 42 | 3300042612 | Ga0466705_201063 | Ga0466705_201063_5994_6266 | 90 |
| 43 | 3300042612 | Ga0466705_203071 | Ga0466705_203071_9943_10215 | 90 |
| 44 | 3300042612 | Ga0466705_291451 | Ga0466705_291451_865_1137 | 90 |
| 45 | 3300042612 | Ga0466705_335356 | Ga0466705_335356_2744_3016 | 90 |
| 46 | 3300042612 | Ga0466705_428371 | Ga0466705_428371_1913_2185 | 90 |
| 47 | 3300042614 | Ga0466712_305246 | Ga0466712_305246_1151_1423 | 90 |
| 48 | 3300042615 | Ga0466711_024648 | Ga0466711_024648_6924_7196 | 90 |
| 49 | 3300042616 | Ga0466715_075345 | Ga0466715_075345_6553_6825 | 90 |
| 50 | 3300042616 | Ga0466715_332812 | Ga0466715_332812_42320_42592 | 90 |
| 51 | 3300042616 | Ga0466715_353133 | Ga0466715_353133_3084_3356 | 90 |
| 52 | 3300042616 | Ga0466715_502939 | Ga0466715_502939_1007_1279 | 90 |
| 53 | 3300042617 | Ga0466718_017393 | Ga0466718_017393_359_631 | 90 |
| 54 | 3300042617 | Ga0466718_041003 | Ga0466718_041003_17200_17472 | 90 |
| 55 | 3300042617 | Ga0466718_072199 | Ga0466718_072199_1902_2174 | 90 |
| 56 | 3300042617 | Ga0466718_122224 | Ga0466718_122224_1360_1632 | 90 |
| 57 | 3300042618 | Ga0466723_010964 | Ga0466723_010964_6105_6377 | 90 |
| 58 | 3300042618 | Ga0466723_014909 | Ga0466723_014909_4372_4644 | 90 |
| 59 | 3300042618 | Ga0466723_035369 | Ga0466723_035369_10808_11080 | 90 |
| 60 | 3300042618 | Ga0466723_109323 | Ga0466723_109323_1365_1637 | 90 |
| 61 | 3300042618 | Ga0466723_152203 | Ga0466723_152203_567_839 | 90 |
| 62 | 3300042618 | Ga0466723_224102 | Ga0466723_224102_1249_1521 | 90 |
| 63 | 3300042618 | Ga0466723_298779 | Ga0466723_298779_1765_2037 | 90 |
| 64 | 3300042620 | Ga0466728_072095 | Ga0466728_072095_928_1200 | 90 |
| 65 | 3300042620 | Ga0466728_089830 | Ga0466728_089830_209_481 | 90 |
| 66 | 3300042620 | Ga0466728_108205 | Ga0466728_108205_191_463 | 90 |
| 67 | 3300042620 | Ga0466728_206166 | Ga0466728_206166_1223_1495 | 90 |
| 68 | 3300042620 | Ga0466728_227597 | Ga0466728_227597_2931_3203 | 90 |
| 69 | 3300042620 | Ga0466728_279718 | Ga0466728_279718_1628_1900 | 90 |
| 70 | 3300042621 | Ga0466729_010101 | Ga0466729_010101_1300_1572 | 90 |
| 71 | 3300042621 | Ga0466729_106339 | Ga0466729_106339_28567_28839 | 90 |
| 72 | 3300042621 | Ga0466729_198692 | Ga0466729_198692_1274_1546 | 90 |
| 73 | 3300042635 | Ga0466702_139598 | Ga0466702_139598_117_389 | 90 |
| 74 | 3300042636 | Ga0466703_017206 | Ga0466703_017206_763_1035 | 90 |
| 75 | 3300042636 | Ga0466703_097247 | Ga0466703_097247_6540_6812 | 90 |
| 76 | 3300042636 | Ga0466703_151287 | Ga0466703_151287_8263_8535 | 90 |
| 77 | 3300042643 | Ga0466704_223283 | Ga0466704_223283_421_693 | 90 |
| 78 | 3300042643 | Ga0466704_296827 | Ga0466704_296827_8616_8888 | 90 |
| 79 | 3300042643 | Ga0466704_349181 | Ga0466704_349181_14808_15080 | 90 |
| 80 | 3300042648 | Ga0466709_208078 | Ga0466709_208078_1341_1763 | 90 |
| 81 | 3300042648 | Ga0466709_342021 | Ga0466709_342021_6243_6515 | 90 |
| 82 | 3300042652 | Ga0466708_111555 | Ga0466708_111555_3036_3308 | 90 |
| 83 | 3300042652 | Ga0466708_252186 | Ga0466708_252186_6676_6948 | 90 |
| 84 | 3300042652 | Ga0466708_429165 | Ga0466708_429165_2251_2523 | 90 |
| 85 | 3300042655 | Ga0466727_131618 | Ga0466727_131618_42_314 | 90 |
| 86 | 3300042655 | Ga0466727_288606 | Ga0466727_288606_344_616 | 90 |
| 87 | 3300002450 | JGI24695J34938_10164438 | JGI24695J34938_101644382 | 91 |
| 88 | 3300005201 | Ga0072941_1525134 | Ga0072941_15251342 | 91 |
| 89 | 3300005485 | Ga0074263_137768 | Ga0074263_1377681 | 91 |
| 90 | 3300009784 | Ga0123357_10104560 | Ga0123357_101045606 | 91 |
| 91 | 3300009784 | Ga0123357_10369173 | Ga0123357_103691732 | 91 |
| 92 | 3300010049 | Ga0123356_11003986 | Ga0123356_110039862 | 91 |
| 93 | 3300010049 | Ga0123356_13319918 | Ga0123356_133199182 | 91 |
| 94 | 3300010167 | Ga0123353_10720492 | Ga0123353_107204923 | 91 |
| 95 | 3300010167 | Ga0123353_12768697 | Ga0123353_127686972 | 91 |
| 96 | 3300010882 | Ga0123354_10494539 | Ga0123354_104945392 | 91 |
| 97 | 3300038395 | Ga0415639_079234 | Ga0415639_079234_445_720 | 91 |
| 98 | 3300042592 | Ga0466693_213369 | Ga0466693_213369_1833_2108 | 91 |
| 99 | 3300042596 | Ga0466696_498014 | Ga0466696_498014_6920_7195 | 91 |
| 100 | 3300042609 | Ga0466722_092653 | Ga0466722_092653_5176_5451 | 91 |
| 101 | 3300042612 | Ga0466705_467261 | Ga0466705_467261_21409_21684 | 91 |
| 102 | 3300042619 | Ga0466726_156194 | Ga0466726_156194_3677_3952 | 91 |
| 103 | 3300042636 | Ga0466703_313337 | Ga0466703_313337_704_979 | 91 |
| 104 | 3300042655 | Ga0466727_141469 | Ga0466727_141469_1491_1766 | 91 |
| 105 | 3300005071 | Ga0068302_10316095 | Ga0068302_103160954 | 92 |
| 106 | 3300009784 | Ga0123357_10216412 | Ga0123357_102164124 | 92 |
| 107 | 3300010049 | Ga0123356_10003912 | Ga0123356_100039124 | 92 |
| 108 | 3300010049 | Ga0123356_10011537 | Ga0123356_100115378 | 92 |
| 109 | 3300010049 | Ga0123356_10021227 | Ga0123356_100212272 | 92 |
| 110 | 3300010049 | Ga0123356_10192597 | Ga0123356_101925972 | 92 |
| 111 | 3300010049 | Ga0123356_10359051 | Ga0123356_103590513 | 92 |
| 112 | 3300010049 | Ga0123356_10431002 | Ga0123356_104310022 | 92 |
| 113 | 3300010049 | Ga0123356_10741868 | Ga0123356_107418682 | 92 |
| 114 | 3300010049 | Ga0123356_12711378 | Ga0123356_127113782 | 92 |
| 115 | 3300042625 | Ga0466730_098132 | Ga0466730_098132_1625_1903 | 92 |
| 116 | 3300042655 | Ga0466727_136338 | Ga0466727_136338_2536_2814 | 92 |
| 117 | 3300042603 | Ga0466714_014006 | Ga0466714_014006_1482_1763 | 93 |
| 118 | 3300042603 | Ga0466714_064295 | Ga0466714_064295_25_306 | 93 |
| 119 | 3300042610 | Ga0466698_433032 | Ga0466698_433032_4069_4350 | 93 |
| 120 | 3300042615 | Ga0466711_172672 | Ga0466711_172672_3457_3738 | 93 |
| 121 | 3300042616 | Ga0466715_198551 | Ga0466715_198551_919_1200 | 93 |
| 122 | 3300009784 | Ga0123357_10409085 | Ga0123357_104090851 | 95 |
| 123 | 3300009784 | Ga0123357_10552101 | Ga0123357_105521011 | 95 |
| 124 | 3300042621 | Ga0466729_092439 | Ga0466729_092439_1323_1610 | 95 |
| 125 | 3300010049 | Ga0123356_10218134 | Ga0123356_102181342 | 96 |
| 126 | 3300010167 | Ga0123353_10056265 | Ga0123353_100562659 | 96 |
| 127 | iso_pr_bacteria | 2820829137 | 2820829558 | 96 |
| 128 | 3300002509 | JGI24699J35502_11134017 | JGI24699J35502_1113401714 | 97 |
| 129 | 3300042603 | Ga0466714_020610 | Ga0466714_020610_1476_1769 | 97 |
| 130 | 3300042592 | Ga0466693_242731 | Ga0466693_242731_515_841 | 98 |
| 131 | 3300042600 | Ga0466700_469984 | Ga0466700_469984_1338_1634 | 98 |
| 132 | 3300042620 | Ga0466728_225114 | Ga0466728_225114_12134_12430 | 98 |
| 133 | 3300005201 | Ga0072941_1046791 | Ga0072941_10467915 | 99 |
| 134 | iso_pr_bacteria | 2820901319 | 2820903435 | 99 |
| 135 | 3300009784 | Ga0123357_10000620 | Ga0123357_1000062026 | 100 |
| 136 | 3300042615 | Ga0466711_453998 | Ga0466711_453998_1232_1537 | 101 |
| 137 | 3300042636 | Ga0466703_222051 | Ga0466703_222051_616_921 | 101 |
| 138 | 3300002509 | JGI24699J35502_11049566 | JGI24699J35502_110495662 | 102 |
| 139 | 3300005201 | Ga0072941_1240704 | Ga0072941_12407041 | 102 |
| 140 | 3300042601 | Ga0466707_332266 | Ga0466707_332266_2593_2901 | 102 |
| 141 | iso_pr_bacteria | 2820944107 | 2820945270 | 102 |
| 142 | 3300002509 | JGI24699J35502_11000967 | JGI24699J35502_110009673 | 103 |
| 143 | 3300009784 | Ga0123357_10121303 | Ga0123357_101213034 | 103 |
| 144 | 3300042602 | Ga0466713_156645 | Ga0466713_156645_582_896 | 104 |
| 145 | 3300010882 | Ga0123354_10176270 | Ga0123354_101762702 | 106 |
| 146 | 3300042602 | Ga0466713_008223 | Ga0466713_008223_73_399 | 108 |
| 147 | 3300042602 | Ga0466713_130188 | Ga0466713_130188_8009_8335 | 108 |
| 148 | 3300042636 | Ga0466703_017494 | Ga0466703_017494_391_717 | 108 |
| 149 | 3300042643 | Ga0466704_308427 | Ga0466704_308427_1614_1940 | 108 |
| 150 | 3300002504 | JGI24705J35276_12194554 | JGI24705J35276_121945543 | 109 |
| 151 | 3300009784 | Ga0123357_10001005 | Ga0123357_1000100519 | 109 |
| 152 | 3300009784 | Ga0123357_10059632 | Ga0123357_100596326 | 109 |
| 153 | 3300009784 | Ga0123357_10157372 | Ga0123357_101573722 | 109 |
| 154 | 3300010882 | Ga0123354_10586566 | Ga0123354_105865662 | 109 |
| 155 | 3300042606 | Ga0466719_418869 | Ga0466719_418869_153_482 | 109 |
| 156 | 3300010882 | Ga0123354_10253592 | Ga0123354_102535922 | 110 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03319 | EutN_CcmL | Ethanolamine utilisation protein EutN/carboxysome | 2 | 80 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03319 | GO:0031469 | bacterial microcompartment | CC |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.74 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.