Protein Family IF07571
Metagenome
Isolate
270
Members
167
Samples
187
Scaffolds
142.09
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_441446|Ga0466711_441446_1743_2234
- Length
- 163 aa
- Sequence
- VKISTARRLSGSSANIRRYFFIMAKKVIGELKLQLPAGKATPAPPVGPALGQRGINIMEFVKQFNAKTADQVGMIIPVVITVYADRSFSFVMKTPPASVLLKKAAGKEKGSGVPNKNFVGKVSRKQVQEIAALKMVDLNAGSIEAAMRMVEGTARSMGVEITS
Sample Types
Isolate
30.7%
Metagenome
69.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Aphididae
28.8%
Unclassified
13.1%
Apidae
11.8%
Termitidae
9.8%
Formicidae
9.8%
Kalotermitidae
9.2%
Culicidae
2.6%
Armadillidiidae
2.6%
Termopsidae
2.6%
Elmidae
2.0%
Hormaphididae
1.3%
Chrysomelidae
1.3%
Rhinotermitidae
1.3%
Daphniidae
0.7%
Aphrophoridae
0.7%
Passalidae
0.7%
Hodotermitidae
0.7%
Hippoboscidae
0.7%
Curculionidae
0.7%
Taxonomy
Archaea
0
Bacteria
234
Eukaryota
0
Viruses
0
Unclassified
36
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 2 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 3 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 4 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 5 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 6 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 7 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 8 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 9 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 10 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 13 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 16 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 17 | 3300009456 | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov | Metagenome | |
| 18 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 19 | 3300009535 | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov | Metagenome | Aphididae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 23 | 3002300227 | Buchnera aphidicola (Nipponaphis monzeni) Nmo | Isolate | Hormaphididae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 26 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 27 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 28 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 29 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 35 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 36 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 37 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 38 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 39 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 40 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 43 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 44 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 45 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 46 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 52 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 53 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 54 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 55 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 56 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 57 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 58 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 59 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 60 | 2998832964 | Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym | Isolate | Chrysomelidae |
| 61 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 62 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 63 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 64 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 65 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 66 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 67 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 68 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 69 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 70 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 71 | 3300009493 | Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov | Metagenome | Hormaphididae |
| 72 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 73 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 74 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 75 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 76 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 77 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 78 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 79 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 80 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 81 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 82 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 83 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 84 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 85 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 86 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 87 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 88 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 89 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 90 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 91 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 92 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 93 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 94 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 95 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 96 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 97 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 98 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 99 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 100 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 101 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 102 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 103 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 104 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 105 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 106 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 107 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 108 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 109 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 110 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 111 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 112 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 113 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 114 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 115 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 116 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 117 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 118 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 119 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 120 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 121 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 122 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 123 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 124 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 125 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 126 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 127 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 128 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 129 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 130 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 131 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 132 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 133 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 134 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 135 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 136 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 137 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 138 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 139 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 140 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 141 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 142 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 143 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 144 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 145 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 146 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 147 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 148 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 149 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 150 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 151 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 152 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 153 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 154 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 155 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 156 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 157 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 158 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 159 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 160 | 2999270917 | Enterobacteriaceae endosymbiont of Neohaemonia nigricornis NnigSym | Isolate | Chrysomelidae |
| 161 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 162 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 163 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 164 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 165 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 166 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 167 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_096004 | 3300042659 | Bacteria | 1054 |
| 2 | Ga0466733_141957 | 3300042659 | Bacteria | 10292 |
| 3 | Ga0466722_126977 | 3300042609 | Bacteria | 24638 |
| 4 | Ga0123356_10461713 | 3300010049 | Bacteria | 1420 |
| 5 | Ga0123356_13450366 | 3300010049 | Unclassified | 548 |
| 6 | HBC_ctgsDRAFT_1024280 | 3300000333 | Unclassified | 1486 |
| 7 | Ga0074278_109712 | 3300005721 | Unclassified | 3641 |
| 8 | Ga0127523_100016 | 3300009456 | Bacteria | 642955 |
| 9 | Ga0127649_109107 | 3300009460 | Bacteria | 19207 |
| 10 | Ga0127530_109138 | 3300009468 | Bacteria | 2480 |
| 11 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 12 | Ga0466703_101066 | 3300042636 | Bacteria | 2585 |
| 13 | Ga0466704_262059 | 3300042643 | Bacteria | 3030 |
| 14 | Ga0160443_101703 | 3300012848 | Bacteria | 6489 |
| 15 | Ga0466690_344848 | 3300042590 | Bacteria | 13223 |
| 16 | Ga0466696_248758 | 3300042596 | Bacteria | 1214 |
| 17 | Ga0466696_317089 | 3300042596 | Bacteria | 6902 |
| 18 | Ga0466696_452473 | 3300042596 | Bacteria | 3266 |
| 19 | Ga0466711_168400 | 3300042615 | Unclassified | 2785 |
| 20 | Ga0466715_517576 | 3300042616 | Bacteria | 14317 |
| 21 | Ga0466715_520179 | 3300042616 | Bacteria | 9946 |
| 22 | Ga0466723_032722 | 3300042618 | Bacteria | 17727 |
| 23 | Ga0466723_170864 | 3300042618 | Bacteria | 1965 |
| 24 | Ga0466723_212793 | 3300042618 | Bacteria | 4126 |
| 25 | Ga0466728_075114 | 3300042620 | Bacteria | 1192 |
| 26 | Ga0123356_11529736 | 3300010049 | Bacteria | 824 |
| 27 | Ga0127530_100232 | 3300009468 | Bacteria | 26084 |
| 28 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 29 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
| 30 | Ga0466735_069402 | 3300042624 | Unclassified | 2042 |
| 31 | Ga0466703_256633 | 3300042636 | Bacteria | 21532 |
| 32 | Ga0466708_164328 | 3300042652 | Bacteria | 13919 |
| 33 | Ga0466708_241130 | 3300042652 | Bacteria | 3644 |
| 34 | Ga0316159_10688 | 3300030930 | Bacteria | 9425 |
| 35 | Ga0466690_356350 | 3300042590 | Unclassified | 2009 |
| 36 | Ga0466691_149870 | 3300042593 | Bacteria | 4195 |
| 37 | Ga0466696_476914 | 3300042596 | Bacteria | 16349 |
| 38 | Ga0466711_441446 | 3300042615 | Bacteria | 3302 |
| 39 | Ga0466715_366385 | 3300042616 | Bacteria | 7763 |
| 40 | Ga0466715_467748 | 3300042616 | Bacteria | 41560 |
| 41 | Ga0466726_050501 | 3300042619 | Bacteria | 15900 |
| 42 | Ga0466728_011959 | 3300042620 | Bacteria | 2494 |
| 43 | Ga0466706_131639 | 3300042599 | Bacteria | 1455 |
| 44 | Ga0466719_193965 | 3300042606 | Unclassified | 4892 |
| 45 | Ga0123355_10047574 | 3300009826 | Bacteria | 6975 |
| 46 | JGI24698J34947_10052165 | 3300002449 | Bacteria | 2053 |
| 47 | CVPL005W_1000507 | 3300002934 | Bacteria | 14992 |
| 48 | Ga0068305_10199692 | 3300005083 | Bacteria | 5559 |
| 49 | Ga0127656_110073 | 3300009453 | Bacteria | 8841 |
| 50 | Ga0466704_269261 | 3300042643 | Unclassified | 2608 |
| 51 | Ga0466709_096367 | 3300042648 | Bacteria | 6538 |
| 52 | Ga0466709_136583 | 3300042648 | Unclassified | 1811 |
| 53 | Ga0466709_420699 | 3300042648 | Bacteria | 3105 |
| 54 | Ga0466727_011289 | 3300042655 | Bacteria | 2872 |
| 55 | Ga0466691_037054 | 3300042593 | Bacteria | 9805 |
| 56 | Ga0466691_042151 | 3300042593 | Unclassified | 1144 |
| 57 | Ga0466691_089260 | 3300042593 | Unclassified | 6162 |
| 58 | Ga0466711_322030 | 3300042615 | Bacteria | 2074 |
| 59 | Ga0466715_599013 | 3300042616 | Bacteria | 3913 |
| 60 | Ga0466723_292549 | 3300042618 | Bacteria | 8877 |
| 61 | Ga0466723_310851 | 3300042618 | Bacteria | 4978 |
| 62 | Ga0466729_155944 | 3300042621 | Bacteria | 3962 |
| 63 | Ga0466707_249881 | 3300042601 | Bacteria | 1759 |
| 64 | Ga0466714_134169 | 3300042603 | Bacteria | 1002 |
| 65 | Ga0466719_172765 | 3300042606 | Bacteria | 5051 |
| 66 | Ga0466719_536468 | 3300042606 | Unclassified | 1559 |
| 67 | IMNBGM34_c016259 | 3300000036 | Bacteria | 927 |
| 68 | JGI24695J34938_10369184 | 3300002450 | Bacteria | 634 |
| 69 | CVPL005L_10012553 | 3300002938 | Bacteria | 6277 |
| 70 | Ga0103266_1000123 | 3300007067 | Unclassified | 33491 |
| 71 | Ga0103264_1000023 | 3300007188 | Bacteria | 103062 |
| 72 | Ga0103264_1001032 | 3300007188 | Unclassified | 12623 |
| 73 | Ga0127526_1000110 | 3300009535 | Bacteria | 643549 |
| 74 | Ga0466703_059314 | 3300042636 | Bacteria | 22828 |
| 75 | Ga0466708_263625 | 3300042652 | Bacteria | 7302 |
| 76 | Ga0309903_100010 | 3300029809 | Bacteria | 52591 |
| 77 | Ga0466657_107181 | 3300042582 | Bacteria | 1786 |
| 78 | Ga0466690_060584 | 3300042590 | Bacteria | 5464 |
| 79 | Ga0466693_203748 | 3300042592 | Bacteria | 8477 |
| 80 | Ga0466696_167469 | 3300042596 | Bacteria | 11721 |
| 81 | Ga0466711_090993 | 3300042615 | Bacteria | 4242 |
| 82 | Ga0466723_282185 | 3300042618 | Bacteria | 1116 |
| 83 | Ga0466726_124852 | 3300042619 | Bacteria | 79186 |
| 84 | Ga0466726_449585 | 3300042619 | Bacteria | 4545 |
| 85 | Ga0466705_017437 | 3300042612 | Bacteria | 17644 |
| 86 | Ga0466733_009011 | 3300042659 | Bacteria | 5230 |
| 87 | Ga0466733_022421 | 3300042659 | Bacteria | 8374 |
| 88 | Ga0466713_057693 | 3300042602 | Bacteria | 2029 |
| 89 | Ga0466714_034475 | 3300042603 | Bacteria | 25200 |
| 90 | Ga0466716_106156 | 3300042605 | Bacteria | 6274 |
| 91 | CVPL010W_10003310 | 3300002931 | Bacteria | 18569 |
| 92 | CVPL010L_1005601 | 3300002932 | Bacteria | 1646 |
| 93 | CVPL005W_1007376 | 3300002934 | Unclassified | 1813 |
| 94 | Ga0068302_10001157 | 3300005071 | Bacteria | 17398 |
| 95 | Ga0103266_1026567 | 3300007067 | Bacteria | 721 |
| 96 | Ga0102734_1000376 | 3300007129 | Bacteria | 37229 |
| 97 | Ga0102734_1008901 | 3300007129 | Unclassified | 2303 |
| 98 | Ga0127657_100003 | 3300009457 | Bacteria | 550482 |
| 99 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 100 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
| 101 | Ga0127651_100210 | 3300009483 | Bacteria | 383772 |
| 102 | Ga0466734_037257 | 3300042623 | Bacteria | 18332 |
| 103 | Ga0466735_216816 | 3300042624 | Bacteria | 2124 |
| 104 | Ga0466708_097984 | 3300042652 | Bacteria | 5932 |
| 105 | Ga0466708_434085 | 3300042652 | Bacteria | 4897 |
| 106 | Ga0255572_1000174 | 3300026175 | Bacteria | 57360 |
| 107 | Ga0415639_214391 | 3300038395 | Bacteria | 1563 |
| 108 | Ga0466691_209111 | 3300042593 | Bacteria | 3432 |
| 109 | Ga0466694_182043 | 3300042594 | Bacteria | 34136 |
| 110 | Ga0466705_522563 | 3300042612 | Bacteria | 1343 |
| 111 | Ga0466711_421355 | 3300042615 | Unclassified | 6727 |
| 112 | Ga0466715_442488 | 3300042616 | Bacteria | 1635 |
| 113 | Ga0466723_143722 | 3300042618 | Bacteria | 1550 |
| 114 | Ga0466723_297790 | 3300042618 | Bacteria | 19421 |
| 115 | Ga0466723_358684 | 3300042618 | Bacteria | 2716 |
| 116 | Ga0466705_309277 | 3300042612 | Bacteria | 2548 |
| 117 | Ga0103268_1107179 | 3300007192 | Unclassified | 692 |
| 118 | Ga0127654_100011 | 3300009493 | Bacteria | 643543 |
| 119 | Ga0466708_364329 | 3300042652 | Bacteria | 54307 |
| 120 | Ga0466708_439833 | 3300042652 | Bacteria | 4199 |
| 121 | Ga0160433_100747 | 3300012846 | Bacteria | 12077 |
| 122 | Ga0160457_1000059 | 3300012858 | Bacteria | 178122 |
| 123 | Ga0160436_1050831 | 3300012861 | Unclassified | 620 |
| 124 | Ga0466696_013869 | 3300042596 | Unclassified | 2426 |
| 125 | Ga0466711_318578 | 3300042615 | Bacteria | 44149 |
| 126 | Ga0466715_458123 | 3300042616 | Bacteria | 3362 |
| 127 | Ga0466715_576135 | 3300042616 | Bacteria | 16833 |
| 128 | Ga0466718_029327 | 3300042617 | Bacteria | 33406 |
| 129 | Ga0466723_228377 | 3300042618 | Bacteria | 3057 |
| 130 | Ga0466726_065607 | 3300042619 | Bacteria | 18562 |
| 131 | Ga0466728_171771 | 3300042620 | Bacteria | 11353 |
| 132 | Ga0466728_223368 | 3300042620 | Unclassified | 3596 |
| 133 | Ga0466705_139440 | 3300042612 | Bacteria | 13706 |
| 134 | Ga0466705_270456 | 3300042612 | Bacteria | 2553 |
| 135 | Ga0466716_143209 | 3300042605 | Bacteria | 24217 |
| 136 | Ga0466716_506413 | 3300042605 | Bacteria | 11245 |
| 137 | Ga0123353_10068371 | 3300010167 | Bacteria | 5704 |
| 138 | CVPL010L_1000002 | 3300002932 | Bacteria | 371144 |
| 139 | Ga0074278_106458 | 3300005721 | Bacteria | 1706 |
| 140 | Ga0102739_1016794 | 3300007095 | Unclassified | 945 |
| 141 | Ga0103264_1000014 | 3300007188 | Bacteria | 121992 |
| 142 | Ga0103264_1000421 | 3300007188 | Bacteria | 21971 |
| 143 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 144 | Ga0127648_100046 | 3300009534 | Bacteria | 171066 |
| 145 | Ga0466703_048013 | 3300042636 | Bacteria | 219350 |
| 146 | Ga0466703_303287 | 3300042636 | Unclassified | 1052 |
| 147 | Ga0466704_036871 | 3300042643 | Bacteria | 192493 |
| 148 | Ga0466709_084883 | 3300042648 | Bacteria | 22322 |
| 149 | Ga0466727_077387 | 3300042655 | Unclassified | 2544 |
| 150 | Ga0160435_1010598 | 3300012857 | Unclassified | 1907 |
| 151 | Ga0466691_045400 | 3300042593 | Bacteria | 23167 |
| 152 | Ga0466696_253683 | 3300042596 | Bacteria | 2727 |
| 153 | Ga0466711_404612 | 3300042615 | Bacteria | 4922 |
| 154 | Ga0466715_025300 | 3300042616 | Unclassified | 14834 |
| 155 | Ga0466723_161996 | 3300042618 | Bacteria | 10035 |
| 156 | Ga0466723_256764 | 3300042618 | Bacteria | 27733 |
| 157 | Ga0466726_305285 | 3300042619 | Bacteria | 4160 |
| 158 | Ga0466728_038839 | 3300042620 | Unclassified | 9729 |
| 159 | Ga0466728_442707 | 3300042620 | Unclassified | 1376 |
| 160 | Ga0466705_249934 | 3300042612 | Bacteria | 4139 |
| 161 | Ga0466713_097467 | 3300042602 | Bacteria | 3813 |
| 162 | Ga0466713_145164 | 3300042602 | Unclassified | 1082 |
| 163 | Ga0123356_13112218 | 3300010049 | Unclassified | 578 |
| 164 | Ga0123353_10255223 | 3300010167 | Unclassified | 2712 |
| 165 | Ga0136160_1000047 | 3300010225 | Bacteria | 637579 |
| 166 | Ga0063521_1001493 | 3300003973 | Bacteria | 6323 |
| 167 | Ga0068302_10023954 | 3300005071 | Bacteria | 3598 |
| 168 | Ga0072941_1307163 | 3300005201 | Unclassified | 1926 |
| 169 | Ga0074278_135239 | 3300005721 | Unclassified | 8947 |
| 170 | Ga0102738_1000016 | 3300007141 | Bacteria | 88310 |
| 171 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 172 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 173 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
| 174 | Ga0466735_170744 | 3300042624 | Bacteria | 3181 |
| 175 | Ga0466708_275872 | 3300042652 | Bacteria | 3583 |
| 176 | Ga0466708_362965 | 3300042652 | Bacteria | 4488 |
| 177 | Ga0160455_103455 | 3300012837 | Unclassified | 2400 |
| 178 | Ga0160472_100083 | 3300012839 | Bacteria | 154330 |
| 179 | Ga0160448_110237 | 3300012854 | Unclassified | 1991 |
| 180 | Ga0309904_1000026 | 3300029810 | Bacteria | 33267 |
| 181 | Ga0466656_364019 | 3300042550 | Bacteria | 1100 |
| 182 | Ga0466711_029711 | 3300042615 | Bacteria | 4400 |
| 183 | Ga0466711_080340 | 3300042615 | Bacteria | 24032 |
| 184 | Ga0466711_495378 | 3300042615 | Bacteria | 3533 |
| 185 | Ga0466715_298660 | 3300042616 | Bacteria | 7345 |
| 186 | Ga0466715_353489 | 3300042616 | Bacteria | 21802 |
| 187 | Ga0466726_161838 | 3300042619 | Unclassified | 1090 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300012861 | Ga0160436_1050831 | Ga0160436_10508311 | 117 |
| 2 | 3300009478 | Ga0127524_100015 | Ga0127524_100015282 | 129 |
| 3 | 3300002932 | CVPL010L_1000002 | CVPL010L_1000002340 | 130 |
| 4 | 3300012854 | Ga0160448_110237 | Ga0160448_1102373 | 132 |
| 5 | 3300002449 | JGI24698J34947_10052165 | JGI24698J34947_100521658 | 136 |
| 6 | 3300042596 | Ga0466696_452473 | Ga0466696_452473_915_1355 | 136 |
| 7 | 3300042636 | Ga0466703_256633 | Ga0466703_256633_2167_2610 | 137 |
| 8 | 3300012837 | Ga0160455_103455 | Ga0160455_1034554 | 139 |
| 9 | 3300042617 | Ga0466718_029327 | Ga0466718_029327_28519_28941 | 140 |
| 10 | 3300042652 | Ga0466708_263625 | Ga0466708_263625_5081_5503 | 140 |
| 11 | iso_pr_bacteria | 2820719201 | 2820719999 | 140 |
| 12 | 3300038395 | Ga0415639_214391 | Ga0415639_214391_1045_1470 | 141 |
| 13 | 3300042550 | Ga0466656_364019 | Ga0466656_364019_630_1055 | 141 |
| 14 | 3300042582 | Ga0466657_107181 | Ga0466657_107181_386_811 | 141 |
| 15 | 3300042590 | Ga0466690_060584 | Ga0466690_060584_3688_4113 | 141 |
| 16 | 3300042590 | Ga0466690_344848 | Ga0466690_344848_4996_5421 | 141 |
| 17 | 3300042590 | Ga0466690_356350 | Ga0466690_356350_618_1043 | 141 |
| 18 | 3300042592 | Ga0466693_203748 | Ga0466693_203748_978_1403 | 141 |
| 19 | 3300042593 | Ga0466691_037054 | Ga0466691_037054_1333_1758 | 141 |
| 20 | 3300042593 | Ga0466691_042151 | Ga0466691_042151_91_516 | 141 |
| 21 | 3300042593 | Ga0466691_045400 | Ga0466691_045400_10363_10788 | 141 |
| 22 | 3300042593 | Ga0466691_089260 | Ga0466691_089260_2399_2824 | 141 |
| 23 | 3300042593 | Ga0466691_149870 | Ga0466691_149870_1392_1817 | 141 |
| 24 | 3300042593 | Ga0466691_209111 | Ga0466691_209111_797_1222 | 141 |
| 25 | 3300042594 | Ga0466694_182043 | Ga0466694_182043_22557_22982 | 141 |
| 26 | 3300042596 | Ga0466696_013869 | Ga0466696_013869_1446_1871 | 141 |
| 27 | 3300042596 | Ga0466696_167469 | Ga0466696_167469_1321_1746 | 141 |
| 28 | 3300042596 | Ga0466696_248758 | Ga0466696_248758_521_946 | 141 |
| 29 | 3300042596 | Ga0466696_253683 | Ga0466696_253683_179_604 | 141 |
| 30 | 3300042596 | Ga0466696_317089 | Ga0466696_317089_6212_6637 | 141 |
| 31 | 3300042596 | Ga0466696_476914 | Ga0466696_476914_13801_14226 | 141 |
| 32 | 3300042599 | Ga0466706_131639 | Ga0466706_131639_917_1342 | 141 |
| 33 | 3300042602 | Ga0466713_057693 | Ga0466713_057693_1504_1929 | 141 |
| 34 | 3300042602 | Ga0466713_097467 | Ga0466713_097467_1307_1732 | 141 |
| 35 | 3300042602 | Ga0466713_145164 | Ga0466713_145164_430_855 | 141 |
| 36 | 3300042603 | Ga0466714_034475 | Ga0466714_034475_2220_2645 | 141 |
| 37 | 3300042605 | Ga0466716_106156 | Ga0466716_106156_4028_4453 | 141 |
| 38 | 3300042605 | Ga0466716_143209 | Ga0466716_143209_8601_9026 | 141 |
| 39 | 3300042605 | Ga0466716_506413 | Ga0466716_506413_1424_1849 | 141 |
| 40 | 3300042606 | Ga0466719_172765 | Ga0466719_172765_4048_4473 | 141 |
| 41 | 3300042606 | Ga0466719_193965 | Ga0466719_193965_240_665 | 141 |
| 42 | 3300042606 | Ga0466719_536468 | Ga0466719_536468_781_1206 | 141 |
| 43 | 3300042612 | Ga0466705_017437 | Ga0466705_017437_15862_16287 | 141 |
| 44 | 3300042612 | Ga0466705_139440 | Ga0466705_139440_1874_2299 | 141 |
| 45 | 3300042612 | Ga0466705_249934 | Ga0466705_249934_2217_2642 | 141 |
| 46 | 3300042612 | Ga0466705_270456 | Ga0466705_270456_1717_2142 | 141 |
| 47 | 3300042612 | Ga0466705_309277 | Ga0466705_309277_676_1101 | 141 |
| 48 | 3300042612 | Ga0466705_522563 | Ga0466705_522563_442_867 | 141 |
| 49 | 3300042615 | Ga0466711_029711 | Ga0466711_029711_2983_3408 | 141 |
| 50 | 3300042615 | Ga0466711_080340 | Ga0466711_080340_6298_6723 | 141 |
| 51 | 3300042615 | Ga0466711_090993 | Ga0466711_090993_2218_2643 | 141 |
| 52 | 3300042615 | Ga0466711_168400 | Ga0466711_168400_2265_2690 | 141 |
| 53 | 3300042615 | Ga0466711_318578 | Ga0466711_318578_33953_34378 | 141 |
| 54 | 3300042615 | Ga0466711_322030 | Ga0466711_322030_97_522 | 141 |
| 55 | 3300042615 | Ga0466711_404612 | Ga0466711_404612_2527_2952 | 141 |
| 56 | 3300042615 | Ga0466711_421355 | Ga0466711_421355_97_522 | 141 |
| 57 | 3300042615 | Ga0466711_495378 | Ga0466711_495378_1538_1963 | 141 |
| 58 | 3300042616 | Ga0466715_025300 | Ga0466715_025300_2714_3139 | 141 |
| 59 | 3300042616 | Ga0466715_298660 | Ga0466715_298660_2229_2654 | 141 |
| 60 | 3300042616 | Ga0466715_353489 | Ga0466715_353489_5414_5839 | 141 |
| 61 | 3300042616 | Ga0466715_366385 | Ga0466715_366385_1366_1791 | 141 |
| 62 | 3300042616 | Ga0466715_442488 | Ga0466715_442488_695_1120 | 141 |
| 63 | 3300042616 | Ga0466715_458123 | Ga0466715_458123_2123_2548 | 141 |
| 64 | 3300042616 | Ga0466715_467748 | Ga0466715_467748_29116_29541 | 141 |
| 65 | 3300042616 | Ga0466715_517576 | Ga0466715_517576_3256_3681 | 141 |
| 66 | 3300042616 | Ga0466715_520179 | Ga0466715_520179_1394_1819 | 141 |
| 67 | 3300042616 | Ga0466715_576135 | Ga0466715_576135_14972_15397 | 141 |
| 68 | 3300042616 | Ga0466715_599013 | Ga0466715_599013_1029_1454 | 141 |
| 69 | 3300042618 | Ga0466723_032722 | Ga0466723_032722_13488_13913 | 141 |
| 70 | 3300042618 | Ga0466723_143722 | Ga0466723_143722_286_711 | 141 |
| 71 | 3300042618 | Ga0466723_161996 | Ga0466723_161996_5316_5741 | 141 |
| 72 | 3300042618 | Ga0466723_170864 | Ga0466723_170864_721_1146 | 141 |
| 73 | 3300042618 | Ga0466723_212793 | Ga0466723_212793_1264_1689 | 141 |
| 74 | 3300042618 | Ga0466723_228377 | Ga0466723_228377_1812_2237 | 141 |
| 75 | 3300042618 | Ga0466723_282185 | Ga0466723_282185_443_868 | 141 |
| 76 | 3300042618 | Ga0466723_297790 | Ga0466723_297790_1396_1821 | 141 |
| 77 | 3300042618 | Ga0466723_310851 | Ga0466723_310851_2404_2829 | 141 |
| 78 | 3300042618 | Ga0466723_358684 | Ga0466723_358684_1308_1733 | 141 |
| 79 | 3300042619 | Ga0466726_050501 | Ga0466726_050501_14103_14528 | 141 |
| 80 | 3300042619 | Ga0466726_065607 | Ga0466726_065607_14733_15158 | 141 |
| 81 | 3300042619 | Ga0466726_124852 | Ga0466726_124852_1744_2169 | 141 |
| 82 | 3300042619 | Ga0466726_161838 | Ga0466726_161838_154_579 | 141 |
| 83 | 3300042619 | Ga0466726_449585 | Ga0466726_449585_2568_2993 | 141 |
| 84 | 3300042620 | Ga0466728_011959 | Ga0466728_011959_1504_1929 | 141 |
| 85 | 3300042620 | Ga0466728_038839 | Ga0466728_038839_1422_1847 | 141 |
| 86 | 3300042620 | Ga0466728_075114 | Ga0466728_075114_384_809 | 141 |
| 87 | 3300042620 | Ga0466728_171771 | Ga0466728_171771_2062_2487 | 141 |
| 88 | 3300042620 | Ga0466728_223368 | Ga0466728_223368_2337_2762 | 141 |
| 89 | 3300042620 | Ga0466728_442707 | Ga0466728_442707_545_970 | 141 |
| 90 | 3300042621 | Ga0466729_155944 | Ga0466729_155944_2186_2611 | 141 |
| 91 | 3300042624 | Ga0466735_069402 | Ga0466735_069402_542_967 | 141 |
| 92 | 3300042636 | Ga0466703_048013 | Ga0466703_048013_168837_169262 | 141 |
| 93 | 3300042636 | Ga0466703_059314 | Ga0466703_059314_1548_1973 | 141 |
| 94 | 3300042636 | Ga0466703_303287 | Ga0466703_303287_424_849 | 141 |
| 95 | 3300042643 | Ga0466704_036871 | Ga0466704_036871_30619_31044 | 141 |
| 96 | 3300042643 | Ga0466704_262059 | Ga0466704_262059_967_1392 | 141 |
| 97 | 3300042643 | Ga0466704_269261 | Ga0466704_269261_1467_1892 | 141 |
| 98 | 3300042648 | Ga0466709_084883 | Ga0466709_084883_4819_5244 | 141 |
| 99 | 3300042648 | Ga0466709_096367 | Ga0466709_096367_2241_2666 | 141 |
| 100 | 3300042648 | Ga0466709_136583 | Ga0466709_136583_1174_1599 | 141 |
| 101 | 3300042648 | Ga0466709_420699 | Ga0466709_420699_2607_3032 | 141 |
| 102 | 3300042652 | Ga0466708_097984 | Ga0466708_097984_3880_4305 | 141 |
| 103 | 3300042652 | Ga0466708_164328 | Ga0466708_164328_11958_12383 | 141 |
| 104 | 3300042652 | Ga0466708_241130 | Ga0466708_241130_1461_1886 | 141 |
| 105 | 3300042652 | Ga0466708_275872 | Ga0466708_275872_2523_2948 | 141 |
| 106 | 3300042652 | Ga0466708_362965 | Ga0466708_362965_910_1335 | 141 |
| 107 | 3300042652 | Ga0466708_364329 | Ga0466708_364329_1395_1820 | 141 |
| 108 | 3300042652 | Ga0466708_434085 | Ga0466708_434085_2187_2612 | 141 |
| 109 | 3300042652 | Ga0466708_439833 | Ga0466708_439833_2287_2712 | 141 |
| 110 | 3300042655 | Ga0466727_011289 | Ga0466727_011289_1382_1807 | 141 |
| 111 | 3300042655 | Ga0466727_077387 | Ga0466727_077387_1347_1772 | 141 |
| 112 | 3300042659 | Ga0466733_009011 | Ga0466733_009011_1493_1918 | 141 |
| 113 | 3300042659 | Ga0466733_022421 | Ga0466733_022421_3729_4154 | 141 |
| 114 | 3300042659 | Ga0466733_096004 | Ga0466733_096004_482_907 | 141 |
| 115 | 3300042659 | Ga0466733_141957 | Ga0466733_141957_1967_2392 | 141 |
| 116 | iso_pr_bacteria | 2718218026 | 2719799958 | 141 |
| 117 | iso_pr_bacteria | 2816332545 | 2818336516 | 141 |
| 118 | iso_pr_bacteria | 2820593525 | 2820593953 | 141 |
| 119 | iso_pr_bacteria | 2841330038 | 2841333091 | 141 |
| 120 | 3300002450 | JGI24695J34938_10369184 | JGI24695J34938_103691841 | 142 |
| 121 | 3300005071 | Ga0068302_10001157 | Ga0068302_1000115710 | 142 |
| 122 | 3300005071 | Ga0068302_10023954 | Ga0068302_100239544 | 142 |
| 123 | 3300005201 | Ga0072941_1307163 | Ga0072941_13071632 | 142 |
| 124 | 3300009826 | Ga0123355_10047574 | Ga0123355_100475745 | 142 |
| 125 | 3300010049 | Ga0123356_10461713 | Ga0123356_104617133 | 142 |
| 126 | 3300010049 | Ga0123356_11529736 | Ga0123356_115297362 | 142 |
| 127 | 3300010049 | Ga0123356_13112218 | Ga0123356_131122181 | 142 |
| 128 | 3300010049 | Ga0123356_13450366 | Ga0123356_134503661 | 142 |
| 129 | 3300010167 | Ga0123353_10068371 | Ga0123353_100683711 | 142 |
| 130 | 3300010167 | Ga0123353_10255223 | Ga0123353_102552235 | 142 |
| 131 | 3300026175 | Ga0255572_1000174 | Ga0255572_100017453 | 142 |
| 132 | 3300029809 | Ga0309903_100010 | Ga0309903_10001045 | 142 |
| 133 | 3300029810 | Ga0309904_1000026 | Ga0309904_100002633 | 142 |
| 134 | 3300030930 | Ga0316159_10688 | Ga0316159_106887 | 142 |
| 135 | iso_pr_bacteria | 2510065004 | 2510076330 | 142 |
| 136 | iso_pr_bacteria | 2511231158 | 2511830121 | 142 |
| 137 | iso_pr_bacteria | 2511231206 | 2511994930 | 142 |
| 138 | iso_pr_bacteria | 2558860194 | 2559121725 | 142 |
| 139 | iso_pr_bacteria | 2558860195 | 2559122335 | 142 |
| 140 | iso_pr_bacteria | 2558860196 | 2559122949 | 142 |
| 141 | iso_pr_bacteria | 2558860197 | 2559123557 | 142 |
| 142 | iso_pr_bacteria | 2585428135 | 2588035572 | 142 |
| 143 | iso_pr_bacteria | 2609459925 | 2610644122 | 142 |
| 144 | iso_pr_bacteria | 2609459958 | 2610824675 | 142 |
| 145 | iso_pr_bacteria | 2627853677 | 2628495627 | 142 |
| 146 | iso_pr_bacteria | 2627854002 | 2629835647 | 142 |
| 147 | iso_pr_bacteria | 2630968716 | 2632958288 | 142 |
| 148 | iso_pr_bacteria | 2636415542 | 2636991504 | 142 |
| 149 | iso_pr_bacteria | 2654587723 | 2655553200 | 142 |
| 150 | iso_pr_bacteria | 2695420964 | 2698252600 | 142 |
| 151 | iso_pr_bacteria | 2718218137 | 2720250832 | 142 |
| 152 | iso_pr_bacteria | 2751185853 | 2753586360 | 142 |
| 153 | iso_pr_bacteria | 2751185856 | 2753591676 | 142 |
| 154 | iso_pr_bacteria | 2751185858 | 2753595514 | 142 |
| 155 | iso_pr_bacteria | 2811995301 | 2813755860 | 142 |
| 156 | iso_pr_bacteria | 2834887098 | 2834887671 | 142 |
| 157 | iso_pr_bacteria | 2846861257 | 2846861839 | 142 |
| 158 | iso_pr_bacteria | 2872745489 | 2872745526 | 142 |
| 159 | iso_pr_bacteria | 2886876212 | 2886876664 | 142 |
| 160 | iso_pr_bacteria | 2896925746 | 2896927658 | 142 |
| 161 | iso_pr_bacteria | 2900132049 | 2900133827 | 142 |
| 162 | iso_pr_bacteria | 2998832964 | 2998833308 | 142 |
| 163 | iso_pr_bacteria | 3002300227 | 3002300259 | 142 |
| 164 | iso_pr_bacteria | 637000043 | 637056058 | 142 |
| 165 | iso_pr_bacteria | 637000045 | 637305927 | 142 |
| 166 | iso_pr_bacteria | 643348520 | 643571417 | 142 |
| 167 | iso_pr_bacteria | 643348522 | 643572007 | 142 |
| 168 | iso_pr_bacteria | 650377915 | 650449656 | 142 |
| 169 | iso_pr_bacteria | 650377916 | 650449036 | 142 |
| 170 | iso_pr_bacteria | 650377917 | 650447815 | 142 |
| 171 | iso_pr_bacteria | 650377918 | 650448424 | 142 |
| 172 | iso_pr_bacteria | 8068941587 | 8068942879 | 142 |
| 173 | iso_pr_bacteria | 8068944069 | 8068945338 | 142 |
| 174 | iso_pr_bacteria | 8068946563 | 8068946646 | 142 |
| 175 | iso_pr_bacteria | 8068950955 | 8068952653 | 142 |
| 176 | iso_pr_bacteria | 8068953321 | 8068954271 | 142 |
| 177 | iso_pr_bacteria | 8068955631 | 8068956553 | 142 |
| 178 | iso_pr_bacteria | 8073617375 | 8073619031 | 142 |
| 179 | iso_pr_bacteria | 8073619611 | 8073620851 | 142 |
| 180 | iso_pr_bacteria | 8073621894 | 8073623573 | 142 |
| 181 | iso_pr_bacteria | 8073624232 | 8073625887 | 142 |
| 182 | iso_pr_bacteria | 8073626464 | 8073626996 | 142 |
| 183 | iso_pr_bacteria | 8073628750 | 8073629715 | 142 |
| 184 | iso_pr_bacteria | 8076029003 | 8076029421 | 142 |
| 185 | iso_pr_bacteria | 8076030444 | 8076030916 | 142 |
| 186 | iso_pr_bacteria | 8076031238 | 8076031668 | 142 |
| 187 | iso_pr_bacteria | 8076031980 | 8076032445 | 142 |
| 188 | iso_pr_bacteria | 8076032775 | 8076033207 | 142 |
| 189 | iso_pr_bacteria | 8076033509 | 8076033953 | 142 |
| 190 | iso_pr_bacteria | 8082291289 | 8082292063 | 142 |
| 191 | iso_pr_bacteria | 8116627632 | 8116630305 | 142 |
| 192 | 3300000333 | HBC_ctgsDRAFT_1024280 | HBC_ctgsDRAFT_10242802 | 143 |
| 193 | 3300002931 | CVPL010W_10003310 | CVPL010W_1000331010 | 143 |
| 194 | 3300002932 | CVPL010L_1005601 | CVPL010L_10056012 | 143 |
| 195 | 3300002934 | CVPL005W_1000507 | CVPL005W_10005072 | 143 |
| 196 | 3300002934 | CVPL005W_1007376 | CVPL005W_10073762 | 143 |
| 197 | 3300002938 | CVPL005L_10012553 | CVPL005L_100125535 | 143 |
| 198 | 3300003973 | Ga0063521_1001493 | Ga0063521_10014936 | 143 |
| 199 | 3300005721 | Ga0074278_106458 | Ga0074278_1064582 | 143 |
| 200 | 3300005721 | Ga0074278_109712 | Ga0074278_1097125 | 143 |
| 201 | 3300005721 | Ga0074278_135239 | Ga0074278_1352394 | 143 |
| 202 | 3300007067 | Ga0103266_1000123 | Ga0103266_100012313 | 143 |
| 203 | 3300007067 | Ga0103266_1026567 | Ga0103266_10265672 | 143 |
| 204 | 3300007095 | Ga0102739_1016794 | Ga0102739_10167941 | 143 |
| 205 | 3300007129 | Ga0102734_1000376 | Ga0102734_100037632 | 143 |
| 206 | 3300007129 | Ga0102734_1008901 | Ga0102734_10089011 | 143 |
| 207 | 3300007141 | Ga0102738_1000016 | Ga0102738_100001667 | 143 |
| 208 | 3300007188 | Ga0103264_1000014 | Ga0103264_100001448 | 143 |
| 209 | 3300007188 | Ga0103264_1000023 | Ga0103264_100002321 | 143 |
| 210 | 3300007188 | Ga0103264_1000421 | Ga0103264_100042124 | 143 |
| 211 | 3300007188 | Ga0103264_1001032 | Ga0103264_10010322 | 143 |
| 212 | 3300007192 | Ga0103268_1107179 | Ga0103268_11071791 | 143 |
| 213 | 3300009456 | Ga0127523_100016 | Ga0127523_10001641 | 143 |
| 214 | 3300009457 | Ga0127657_100003 | Ga0127657_100003479 | 143 |
| 215 | 3300009460 | Ga0127649_109107 | Ga0127649_10910719 | 143 |
| 216 | 3300009461 | Ga0127645_100025 | Ga0127645_100025401 | 143 |
| 217 | 3300009463 | Ga0127644_100036 | Ga0127644_100036194 | 143 |
| 218 | 3300009468 | Ga0127530_100232 | Ga0127530_10023228 | 143 |
| 219 | 3300009468 | Ga0127530_109138 | Ga0127530_1091383 | 143 |
| 220 | 3300009477 | Ga0127522_100011 | Ga0127522_100011418 | 143 |
| 221 | 3300009479 | Ga0127529_1000015 | Ga0127529_1000015143 | 143 |
| 222 | 3300009493 | Ga0127654_100011 | Ga0127654_100011447 | 143 |
| 223 | 3300009531 | Ga0127525_100070 | Ga0127525_100070268 | 143 |
| 224 | 3300009534 | Ga0127648_100046 | Ga0127648_10004695 | 143 |
| 225 | 3300010225 | Ga0136160_1000047 | Ga0136160_1000047163 | 143 |
| 226 | 3300042623 | Ga0466734_037257 | Ga0466734_037257_17781_18212 | 143 |
| 227 | iso_pr_bacteria | 2556921669 | 2558277946 | 143 |
| 228 | iso_pr_bacteria | 2582581321 | 2585353525 | 143 |
| 229 | iso_pr_bacteria | 2619619079 | 2620604563 | 143 |
| 230 | iso_pr_bacteria | 2828301124 | 2828304547 | 143 |
| 231 | iso_pr_bacteria | 2833478085 | 2833478876 | 143 |
| 232 | iso_pr_bacteria | 2841132873 | 2841132894 | 143 |
| 233 | iso_pr_bacteria | 2843639003 | 2843639025 | 143 |
| 234 | iso_pr_bacteria | 2864955722 | 2864958843 | 143 |
| 235 | iso_pr_bacteria | 2864993140 | 2864997455 | 143 |
| 236 | iso_pr_bacteria | 2873468275 | 2873472591 | 143 |
| 237 | iso_pr_bacteria | 2884492481 | 2884492503 | 143 |
| 238 | iso_pr_bacteria | 2884492905 | 2884492928 | 143 |
| 239 | iso_pr_bacteria | 2884497005 | 2884497029 | 143 |
| 240 | iso_pr_bacteria | 2884498641 | 2884498663 | 143 |
| 241 | iso_pr_bacteria | 2884499693 | 2884499714 | 143 |
| 242 | iso_pr_bacteria | 2884500114 | 2884500136 | 143 |
| 243 | iso_pr_bacteria | 2884500535 | 2884500559 | 143 |
| 244 | iso_pr_bacteria | 2887836388 | 2887836411 | 143 |
| 245 | iso_pr_bacteria | 2999270917 | 2999271248 | 143 |
| 246 | iso_pr_bacteria | 650716012 | 650926223 | 143 |
| 247 | 3300000036 | IMNBGM34_c016259 | IMNBGM34_0162592 | 144 |
| 248 | 3300009482 | Ga0127527_100008 | Ga0127527_100008197 | 144 |
| 249 | 3300012839 | Ga0160472_100083 | Ga0160472_100083107 | 144 |
| 250 | 3300012846 | Ga0160433_100747 | Ga0160433_10074710 | 144 |
| 251 | 3300012848 | Ga0160443_101703 | Ga0160443_1017036 | 144 |
| 252 | 3300012857 | Ga0160435_1010598 | Ga0160435_10105981 | 144 |
| 253 | 3300012858 | Ga0160457_1000059 | Ga0160457_100005975 | 144 |
| 254 | 3300005083 | Ga0068305_10199692 | Ga0068305_101996924 | 145 |
| 255 | 3300009453 | Ga0127656_110073 | Ga0127656_1100736 | 145 |
| 256 | 3300009539 | Ga0127521_100003 | Ga0127521_100003595 | 145 |
| 257 | 3300042609 | Ga0466722_126977 | Ga0466722_126977_17757_18197 | 146 |
| 258 | 3300042624 | Ga0466735_170744 | Ga0466735_170744_2306_2746 | 146 |
| 259 | iso_pr_bacteria | 639633012 | 639633038 | 146 |
| 260 | 3300009535 | Ga0127526_1000110 | Ga0127526_100011042 | 147 |
| 261 | 3300042624 | Ga0466735_216816 | Ga0466735_216816_23_466 | 147 |
| 262 | 3300009483 | Ga0127651_100210 | Ga0127651_100210337 | 149 |
| 263 | 3300009533 | Ga0127528_1000015 | Ga0127528_1000015441 | 149 |
| 264 | 3300042603 | Ga0466714_134169 | Ga0466714_134169_511_960 | 149 |
| 265 | 3300042636 | Ga0466703_101066 | Ga0466703_101066_1274_1741 | 155 |
| 266 | 3300042601 | Ga0466707_249881 | Ga0466707_249881_1053_1523 | 156 |
| 267 | 3300042618 | Ga0466723_256764 | Ga0466723_256764_1529_2002 | 157 |
| 268 | 3300042618 | Ga0466723_292549 | Ga0466723_292549_7359_7832 | 157 |
| 269 | 3300042619 | Ga0466726_305285 | Ga0466726_305285_1417_1899 | 160 |
| 270 | 3300042615 | Ga0466711_441446 | Ga0466711_441446_1743_2234 | 163 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.68 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.