Protein Family IF07566

Metagenome Isolate
118 Members
49 Samples
112 Scaffolds
379.52 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_418837|Ga0466711_418837_5348_6616
Length
422 aa
Sequence
MRQPTPKRRSPSQKVHSLVYNSKISCKFADKLMKLQDNMQYKSNIARFFKLQDIENDSVFLFGARQTGKTTFLKQNFPNAKYYDLLQVNKYEQLSRNPSLLREELMSCAENEIVIIDEIQKIPQLLDEVQWLIVNKNLRFILSGSSARKLKRTGANLLGGRALTNRLFPLVSIEIPDFDIIKAVNNGMLPRHYLIDNAWRRIQSYVGTYLGEEIKAEALVRNLSSFNRFLEVAALTNGEIVNYQNIASDCGVSINTIKEYFSIISDTLIGFMLPSFQKTLKRRIIQAPKFYYFDVGITNYLLNRKNLQPGSTDFGQAFEQFVILEIMAYLNYTNNENKMSYWRTSTGIEVDIILGDAKVAIEVKSSSEVQPRHIKGVNLFAEEYPAARLIIVSLDTVARKKGNVDIMPYSQFFQDLWSGQII

📊 Sample Types

Isolate 5.1%
Metagenome 94.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 54.2%
Kalotermitidae 20.8%
Unclassified 16.7%
Passalidae 4.2%
Termopsidae 2.1%
Rhinotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 1
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
14 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
15 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
35 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
36 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
39 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
44 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
45 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
48 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
49 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_016414 3300042614 Bacteria 4065
2 Ga0466726_486473 3300042619 Bacteria 3849
3 Ga0123356_10016562 3300010049 Bacteria 7029
4 Ga0123353_10091298 3300010167 Bacteria 4906
5 Ga0466707_212953 3300042601 Bacteria 1561
6 Ga0466724_44490 3300042649 Bacteria 1711
7 JGI24696J40584_12937608 3300002834 Bacteria 1607
8 Ga0466705_213393 3300042612 Bacteria 2333
9 Ga0466710_196907 3300042613 Bacteria 1726
10 Ga0466711_348306 3300042615 Bacteria 6754
11 Ga0466723_255894 3300042618 Bacteria 6446
12 Ga0466726_086464 3300042619 Bacteria 1795
13 Ga0123356_10133720 3300010049 Bacteria 2434
14 Ga0123354_10035066 3300010882 Bacteria 7837
15 Ga0466690_057279 3300042590 Bacteria 2082
16 Ga0466693_060591 3300042592 Unclassified 2145
17 Ga0466691_010074 3300042593 Bacteria 2172
18 Ga0466707_393127 3300042601 Bacteria 1293
19 Ga0466719_056213 3300042606 Bacteria 1505
20 Ga0466731_311418 3300042622 Bacteria 1599
21 Ga0466709_180813 3300042648 Bacteria 1511
22 IMNBL1DRAFT_c0000782 3300000062 Bacteria 25148
23 IMNBL1DRAFT_c0013134 3300000062 Bacteria 3739
24 Ga0466711_103159 3300042615 Bacteria 20028
25 Ga0466715_378486 3300042616 Bacteria 2886
26 Ga0466715_604665 3300042616 Bacteria 3958
27 Ga0123355_10499441 3300009826 Bacteria 1501
28 Ga0123356_10035820 3300010049 Bacteria 4633
29 Ga0123356_10171056 3300010049 Bacteria 2183
30 Ga0123353_10388870 3300010167 Bacteria 2082
31 Ga0123353_10406979 3300010167 Bacteria 2022
32 Ga0123353_10656917 3300010167 Unclassified 1483
33 Ga0466691_069036 3300042593 Bacteria 24151
34 Ga0466691_227279 3300042593 Bacteria 59500
35 Ga0466695_334608 3300042595 Bacteria 1457
36 Ga0466710_285892 3300042613 Bacteria 3788
37 Ga0466711_009946 3300042615 Bacteria 11036
38 Ga0466711_228465 3300042615 Bacteria 2854
39 Ga0466711_418837 3300042615 Bacteria 6988
40 Ga0123357_10006008 3300009784 Bacteria 14677
41 Ga0123353_10046071 3300010167 Bacteria 6925
42 Ga0466690_181180 3300042590 Bacteria 1452
43 Ga0466695_106321 3300042595 Bacteria 1391
44 Ga0466701_048030 3300042598 Bacteria 5706
45 Ga0466698_087646 3300042610 Bacteria 6595
46 Ga0466734_039803 3300042623 Bacteria 2247
47 Ga0466708_083507 3300042652 Bacteria 23062
48 JGI24702J35022_10004085 3300002462 Bacteria 8733
49 JGI24702J35022_10004603 3300002462 Unclassified 8176
50 JGI24702J35022_10076525 3300002462 Bacteria 1808
51 Ga0466697_191780 3300042611 Bacteria 2474
52 Ga0466711_057793 3300042615 Bacteria 2825
53 Ga0466729_118237 3300042621 Bacteria 2918
54 Ga0466729_141075 3300042621 Bacteria 2159
55 Ga0123357_10148122 3300009784 Bacteria 2859
56 Ga0123353_10098175 3300010167 Bacteria 4721
57 Ga0123354_10116965 3300010882 Bacteria 3473
58 Ga0123354_10334120 3300010882 Bacteria 1376
59 Ga0466693_398265 3300042592 Unclassified 1515
60 Ga0466691_035740 3300042593 Bacteria 1541
61 Ga0466694_092973 3300042594 Bacteria 2014
62 Ga0466694_257437 3300042594 Bacteria 4410
63 Ga0466699_263680 3300042597 Bacteria 2978
64 Ga0466713_018111 3300042602 Bacteria 10312
65 Ga0466717_283222 3300042604 Bacteria 2818
66 Ga0466719_361566 3300042606 Bacteria 1480
67 Ga0466698_342585 3300042610 Bacteria 2855
68 Ga0466724_64068 3300042649 Bacteria 6060
69 IMNBL1DRAFT_c0027409 3300000062 Bacteria 2143
70 Ga0123355_10005609 3300009826 Bacteria 18412
71 Ga0123356_10049634 3300010049 Bacteria 3906
72 Ga0123356_10102748 3300010049 Bacteria 2744
73 Ga0123353_10022853 3300010167 Bacteria 9446
74 Ga0123354_10139152 3300010882 Bacteria 3015
75 Ga0415639_083413 3300038395 Bacteria 2080
76 Ga0466707_190130 3300042601 Bacteria 8891
77 Ga0466713_147833 3300042602 Bacteria 21805
78 Ga0466729_311384 3300042621 Bacteria 1572
79 IMNBL1DRAFT_c0003508 3300000062 Bacteria 10031
80 IMNBL1DRAFT_c0030869 3300000062 Bacteria 1957
81 JGI24702J35022_10019440 3300002462 Bacteria 3694
82 JGI24702J35022_10045458 3300002462 Bacteria 2339
83 JGI24705J35276_12183550 3300002504 Bacteria 1392
84 JGI24705J35276_12190781 3300002504 Unclassified 1467
85 Ga0466705_125805 3300042612 Bacteria 2486
86 Ga0466729_040098 3300042621 Bacteria 2825
87 Ga0123353_10043524 3300010167 Bacteria 7114
88 Ga0123353_10098924 3300010167 Bacteria 4701
89 Ga0123354_10175706 3300010882 Bacteria 2469
90 Ga0466694_371808 3300042594 Bacteria 1822
91 Ga0466719_082112 3300042606 Bacteria 2997
92 Ga0466721_326148 3300042608 Bacteria 5270
93 Ga0466721_367982 3300042608 Bacteria 2427
94 2227544067 2225789004 Bacteria 15494
95 JGI24702J35022_10094324 3300002462 Bacteria 1632
96 Ga0072940_1219807 3300005200 Bacteria 2440
97 Ga0466710_102486 3300042613 Bacteria 2801
98 Ga0466710_320021 3300042613 Bacteria 1240
99 Ga0466718_072358 3300042617 Viruses 1828
100 Ga0466726_191264 3300042619 Bacteria 2292
101 Ga0466728_412712 3300042620 Bacteria 7557
102 Ga0123357_10185742 3300009784 Bacteria 2412
103 Ga0123353_10000348 3300010167 Bacteria 56584
104 Ga0123354_10039730 3300010882 Bacteria 7288
105 Ga0123354_10186615 3300010882 Bacteria 2342
106 Ga0123354_10281238 3300010882 Bacteria 1615
107 Ga0466701_040170 3300042598 Bacteria 2321
108 Ga0466701_045352 3300042598 Bacteria 6411
109 2227588234 2225789004 Bacteria 2446
110 JGI24695J34938_10004478 3300002450 Bacteria 9140
111 JGI24702J35022_10066115 3300002462 Bacteria 1940
112 Ga0072941_1057827 3300005201 Bacteria 4926

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_398265 Ga0466693_398265_476_1483 335
2 3300042613 Ga0466710_285892 Ga0466710_285892_26_1069 347
3 3300010167 Ga0123353_10656917 Ga0123353_106569171 361
4 3300002462 JGI24702J35022_10004603 JGI24702J35022_100046038 366
5 3300042601 Ga0466707_212953 Ga0466707_212953_297_1412 371
6 3300042621 Ga0466729_040098 Ga0466729_040098_187_1302 371
7 3300005200 Ga0072940_1219807 Ga0072940_12198071 372
8 3300042593 Ga0466691_010074 Ga0466691_010074_245_1363 372
9 3300042615 Ga0466711_057793 Ga0466711_057793_1276_2394 372
10 3300042601 Ga0466707_190130 Ga0466707_190130_4800_5924 374
11 2225789004 2227544067 2228068017 379
12 2225789004 2227588234 2228144830 379
13 3300010882 Ga0123354_10281238 Ga0123354_102812382 379
14 3300038395 Ga0415639_083413 Ga0415639_083413_443_1582 379
15 3300042590 Ga0466690_181180 Ga0466690_181180_217_1356 379
16 3300042593 Ga0466691_035740 Ga0466691_035740_347_1486 379
17 3300042593 Ga0466691_069036 Ga0466691_069036_2774_3913 379
18 3300042593 Ga0466691_227279 Ga0466691_227279_54791_55930 379
19 3300042594 Ga0466694_092973 Ga0466694_092973_214_1353 379
20 3300042594 Ga0466694_371808 Ga0466694_371808_499_1638 379
21 3300042595 Ga0466695_334608 Ga0466695_334608_169_1308 379
22 3300042597 Ga0466699_263680 Ga0466699_263680_1762_2901 379
23 3300042598 Ga0466701_040170 Ga0466701_040170_604_1743 379
24 3300042602 Ga0466713_018111 Ga0466713_018111_5913_7052 379
25 3300042602 Ga0466713_147833 Ga0466713_147833_1760_2899 379
26 3300042606 Ga0466719_056213 Ga0466719_056213_164_1303 379
27 3300042606 Ga0466719_082112 Ga0466719_082112_132_1271 379
28 3300042606 Ga0466719_361566 Ga0466719_361566_207_1346 379
29 3300042608 Ga0466721_326148 Ga0466721_326148_2209_3348 379
30 3300042610 Ga0466698_342585 Ga0466698_342585_1686_2825 379
31 3300042612 Ga0466705_125805 Ga0466705_125805_1064_2203 379
32 3300042613 Ga0466710_102486 Ga0466710_102486_1488_2627 379
33 3300042613 Ga0466710_320021 Ga0466710_320021_51_1190 379
34 3300042615 Ga0466711_009946 Ga0466711_009946_540_1679 379
35 3300042615 Ga0466711_228465 Ga0466711_228465_1465_2604 379
36 3300042615 Ga0466711_348306 Ga0466711_348306_3702_4841 379
37 3300042616 Ga0466715_378486 Ga0466715_378486_1167_2306 379
38 3300042617 Ga0466718_072358 Ga0466718_072358_350_1489 379
39 3300042619 Ga0466726_486473 Ga0466726_486473_908_2047 379
40 3300042620 Ga0466728_412712 Ga0466728_412712_5488_6627 379
41 3300042623 Ga0466734_039803 Ga0466734_039803_105_1244 379
42 3300042649 Ga0466724_44490 Ga0466724_44490_381_1520 379
43 3300042649 Ga0466724_64068 Ga0466724_64068_4815_5954 379
44 3300042652 Ga0466708_083507 Ga0466708_083507_7129_8268 379
45 iso_pr_bacteria 2820765201 2820766467 379
46 iso_pr_bacteria 2820785563 2820786622 379
47 iso_pr_bacteria 2820797595 2820798695 379
48 3300000062 IMNBL1DRAFT_c0000782 IMNBL1DRAFT_000078217 380
49 3300000062 IMNBL1DRAFT_c0003508 IMNBL1DRAFT_000350812 380
50 3300000062 IMNBL1DRAFT_c0013134 IMNBL1DRAFT_00131342 380
51 3300000062 IMNBL1DRAFT_c0027409 IMNBL1DRAFT_00274092 380
52 3300000062 IMNBL1DRAFT_c0030869 IMNBL1DRAFT_00308692 380
53 3300002450 JGI24695J34938_10004478 JGI24695J34938_100044784 380
54 3300002462 JGI24702J35022_10019440 JGI24702J35022_100194402 380
55 3300002462 JGI24702J35022_10066115 JGI24702J35022_100661152 380
56 3300002462 JGI24702J35022_10076525 JGI24702J35022_100765252 380
57 3300002504 JGI24705J35276_12183550 JGI24705J35276_121835501 380
58 3300002834 JGI24696J40584_12937608 JGI24696J40584_129376081 380
59 3300005201 Ga0072941_1057827 Ga0072941_10578272 380
60 3300009784 Ga0123357_10185742 Ga0123357_101857422 380
61 3300009826 Ga0123355_10005609 Ga0123355_100056093 380
62 3300009826 Ga0123355_10499441 Ga0123355_104994411 380
63 3300010049 Ga0123356_10035820 Ga0123356_100358205 380
64 3300010049 Ga0123356_10049634 Ga0123356_100496342 380
65 3300010049 Ga0123356_10102748 Ga0123356_101027481 380
66 3300010049 Ga0123356_10133720 Ga0123356_101337202 380
67 3300010167 Ga0123353_10022853 Ga0123353_100228532 380
68 3300010167 Ga0123353_10091298 Ga0123353_100912985 380
69 3300010167 Ga0123353_10098175 Ga0123353_100981753 380
70 3300010882 Ga0123354_10035066 Ga0123354_100350661 380
71 3300010882 Ga0123354_10039730 Ga0123354_100397301 380
72 3300010882 Ga0123354_10116965 Ga0123354_101169656 380
73 3300010882 Ga0123354_10139152 Ga0123354_101391522 380
74 3300010882 Ga0123354_10175706 Ga0123354_101757062 380
75 3300010882 Ga0123354_10186615 Ga0123354_101866152 380
76 3300010882 Ga0123354_10334120 Ga0123354_103341202 380
77 3300042592 Ga0466693_060591 Ga0466693_060591_66_1208 380
78 3300042594 Ga0466694_257437 Ga0466694_257437_1192_2334 380
79 3300042595 Ga0466695_106321 Ga0466695_106321_23_1165 380
80 3300042598 Ga0466701_045352 Ga0466701_045352_2081_3223 380
81 3300042601 Ga0466707_393127 Ga0466707_393127_58_1200 380
82 3300042604 Ga0466717_283222 Ga0466717_283222_706_1848 380
83 3300042610 Ga0466698_087646 Ga0466698_087646_3939_5081 380
84 3300042611 Ga0466697_191780 Ga0466697_191780_64_1206 380
85 3300042612 Ga0466705_213393 Ga0466705_213393_596_1738 380
86 3300042613 Ga0466710_196907 Ga0466710_196907_409_1551 380
87 3300042616 Ga0466715_604665 Ga0466715_604665_2452_3594 380
88 3300042618 Ga0466723_255894 Ga0466723_255894_788_1930 380
89 3300042619 Ga0466726_086464 Ga0466726_086464_401_1543 380
90 3300042619 Ga0466726_191264 Ga0466726_191264_178_1320 380
91 3300042621 Ga0466729_311384 Ga0466729_311384_404_1546 380
92 iso_pr_bacteria 2820746860 2820747204 380
93 3300002462 JGI24702J35022_10004085 JGI24702J35022_100040854 381
94 3300002462 JGI24702J35022_10045458 JGI24702J35022_100454582 381
95 3300002462 JGI24702J35022_10094324 JGI24702J35022_100943242 381
96 3300002504 JGI24705J35276_12190781 JGI24705J35276_121907811 381
97 3300009784 Ga0123357_10006008 Ga0123357_1000600813 381
98 3300009784 Ga0123357_10148122 Ga0123357_101481222 381
99 3300010049 Ga0123356_10171056 Ga0123356_101710563 381
100 3300010167 Ga0123353_10000348 Ga0123353_1000034850 381
101 3300010167 Ga0123353_10046071 Ga0123353_100460713 381
102 3300042590 Ga0466690_057279 Ga0466690_057279_234_1379 381
103 3300042598 Ga0466701_048030 Ga0466701_048030_390_1535 381
104 3300042614 Ga0466712_016414 Ga0466712_016414_2303_3448 381
105 3300042621 Ga0466729_141075 Ga0466729_141075_97_1242 381
106 3300042648 Ga0466709_180813 Ga0466709_180813_224_1369 381
107 iso_pr_bacteria 2820744581 2820745925 381
108 3300010049 Ga0123356_10016562 Ga0123356_100165624 382
109 3300010167 Ga0123353_10043524 Ga0123353_100435246 382
110 3300010167 Ga0123353_10388870 Ga0123353_103888702 382
111 3300010167 Ga0123353_10406979 Ga0123353_104069792 382
112 3300042622 Ga0466731_311418 Ga0466731_311418_279_1427 382
113 3300042608 Ga0466721_367982 Ga0466721_367982_349_1500 383
114 3300010167 Ga0123353_10098924 Ga0123353_100989245 384
115 iso_pr_bacteria 2820781750 2820782608 393
116 3300042621 Ga0466729_118237 Ga0466729_118237_467_1678 403
117 3300042615 Ga0466711_103159 Ga0466711_103159_456_1685 409
118 3300042615 Ga0466711_418837 Ga0466711_418837_5348_6616 422

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13635 DUF4143 Domain of unknown function (DUF4143) 213 366 0.94
PF13173 AAA_14 AAA domain 57 171 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.