Protein Family IF07561
Metagenome
117
Members
41
Samples
117
Scaffolds
208.5
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_393032|Ga0466711_393032_27_698
- Length
- 223 aa
- Sequence
- MAPKENLPVIKPFNPLDKLNLGESVAGALLEASAQPLPPSQFIGAGVYALYYKGPFPAYLGLSKLNSDGQFRCPIYVGKAVPAGARKGGFGLEIEHGQALYKRLFEHAESIKATRNLELNDFFCRFLVVDDIWIPLAESVLIERFKPVWNRVLDGFGNHDPGSGRHSGRMPPWDCLHPGREWATRLQPCAFTQEQLEERVTTYLNSLLPYYDYPLRRQAFGLP
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Kalotermitidae
28.2%
Rhinotermitidae
7.7%
Termopsidae
7.7%
Formicidae
5.1%
Passalidae
2.6%
Hodotermitidae
2.6%
Unclassified
2.6%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 22 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_041058 | 3300038395 | Bacteria | 4982 |
| 2 | Ga0466696_252438 | 3300042596 | Bacteria | 1873 |
| 3 | Ga0466715_270979 | 3300042616 | Bacteria | 3286 |
| 4 | Ga0466715_373542 | 3300042616 | Bacteria | 7706 |
| 5 | Ga0466718_122099 | 3300042617 | Bacteria | 1836 |
| 6 | Ga0466726_068422 | 3300042619 | Bacteria | 1544 |
| 7 | Ga0123353_10461863 | 3300010167 | Bacteria | 1865 |
| 8 | Ga0466703_075893 | 3300042636 | Bacteria | 79682 |
| 9 | Ga0466703_349595 | 3300042636 | Bacteria | 5874 |
| 10 | Ga0466708_109343 | 3300042652 | Bacteria | 4695 |
| 11 | Ga0068302_10052272 | 3300005071 | Bacteria | 2637 |
| 12 | Ga0072940_1095149 | 3300005200 | Bacteria | 3038 |
| 13 | Ga0466706_094043 | 3300042599 | Bacteria | 6520 |
| 14 | Ga0466707_129075 | 3300042601 | Bacteria | 44398 |
| 15 | Ga0466697_051618 | 3300042611 | Bacteria | 2604 |
| 16 | Ga0466705_070696 | 3300042612 | Bacteria | 13750 |
| 17 | Ga0466705_350180 | 3300042612 | Bacteria | 38390 |
| 18 | Ga0466705_397621 | 3300042612 | Unclassified | 2683 |
| 19 | Ga0466711_393032 | 3300042615 | Bacteria | 1150 |
| 20 | Ga0466718_038505 | 3300042617 | Bacteria | 1654 |
| 21 | Ga0466723_093620 | 3300042618 | Bacteria | 2617 |
| 22 | Ga0466726_246675 | 3300042619 | Bacteria | 3600 |
| 23 | Ga0466726_469424 | 3300042619 | Bacteria | 4150 |
| 24 | Ga0466728_464326 | 3300042620 | Bacteria | 1355 |
| 25 | Ga0123355_10043580 | 3300009826 | Bacteria | 7301 |
| 26 | Ga0123356_10002883 | 3300010049 | Bacteria | 18206 |
| 27 | Ga0466704_184409 | 3300042643 | Bacteria | 94982 |
| 28 | Ga0068302_10088034 | 3300005071 | Bacteria | 2725 |
| 29 | Ga0466706_019635 | 3300042599 | Bacteria | 13753 |
| 30 | Ga0466706_123406 | 3300042599 | Bacteria | 13132 |
| 31 | Ga0466714_031718 | 3300042603 | Bacteria | 3024 |
| 32 | Ga0264413_146491 | 3300024493 | Bacteria | 4878 |
| 33 | Ga0466693_189479 | 3300042592 | Bacteria | 48655 |
| 34 | Ga0466691_090473 | 3300042593 | Bacteria | 3174 |
| 35 | Ga0466711_044975 | 3300042615 | Bacteria | 1394 |
| 36 | Ga0123353_10215475 | 3300010167 | Bacteria | 3008 |
| 37 | Ga0123353_10409305 | 3300010167 | Unclassified | 2015 |
| 38 | Ga0466702_104720 | 3300042635 | Bacteria | 2646 |
| 39 | Ga0466703_125033 | 3300042636 | Bacteria | 2034 |
| 40 | Ga0466714_129695 | 3300042603 | Bacteria | 11448 |
| 41 | Ga0466722_233627 | 3300042609 | Unclassified | 2343 |
| 42 | Ga0466705_062246 | 3300042612 | Bacteria | 22991 |
| 43 | Ga0466715_194201 | 3300042616 | Bacteria | 71832 |
| 44 | Ga0466723_320347 | 3300042618 | Bacteria | 5052 |
| 45 | Ga0466726_077664 | 3300042619 | Bacteria | 9989 |
| 46 | Ga0466726_201784 | 3300042619 | Bacteria | 8147 |
| 47 | Ga0123355_10230497 | 3300009826 | Bacteria | 2645 |
| 48 | Ga0123356_10070098 | 3300010049 | Bacteria | 3288 |
| 49 | Ga0123353_10301666 | 3300010167 | Bacteria | 2444 |
| 50 | Ga0466702_396991 | 3300042635 | Bacteria | 1293 |
| 51 | Ga0466702_433032 | 3300042635 | Bacteria | 1795 |
| 52 | Ga0466703_360789 | 3300042636 | Bacteria | 1594 |
| 53 | AustNasuHG_c1013093 | 3300000089 | Bacteria | 2851 |
| 54 | AustNasuHG_c1044157 | 3300000089 | Bacteria | 1036 |
| 55 | CVPL010W_10000817 | 3300002931 | Bacteria | 59122 |
| 56 | Ga0072941_1143880 | 3300005201 | Bacteria | 2927 |
| 57 | Ga0466721_167518 | 3300042608 | Bacteria | 1308 |
| 58 | Ga0466705_218107 | 3300042612 | Bacteria | 15905 |
| 59 | Ga0466705_238482 | 3300042612 | Bacteria | 4106 |
| 60 | Ga0466692_047586 | 3300042591 | Bacteria | 1792 |
| 61 | Ga0466715_149184 | 3300042616 | Bacteria | 6752 |
| 62 | Ga0466715_468588 | 3300042616 | Bacteria | 2602 |
| 63 | Ga0466726_124252 | 3300042619 | Bacteria | 9505 |
| 64 | Ga0123355_10312620 | 3300009826 | Bacteria | 2127 |
| 65 | Ga0123353_11185545 | 3300010167 | Bacteria | 1004 |
| 66 | Ga0466702_134939 | 3300042635 | Bacteria | 1210 |
| 67 | Ga0466703_198272 | 3300042636 | Bacteria | 4662 |
| 68 | Ga0123357_10000772 | 3300009784 | Bacteria | 32302 |
| 69 | Ga0466706_280834 | 3300042599 | Bacteria | 117276 |
| 70 | Ga0466717_225702 | 3300042604 | Bacteria | 1193 |
| 71 | Ga0466705_055438 | 3300042612 | Bacteria | 55057 |
| 72 | Ga0466705_254472 | 3300042612 | Bacteria | 5487 |
| 73 | Ga0466705_258880 | 3300042612 | Bacteria | 4508 |
| 74 | Ga0466711_165246 | 3300042615 | Bacteria | 3624 |
| 75 | Ga0466715_321032 | 3300042616 | Bacteria | 166710 |
| 76 | Ga0466726_397243 | 3300042619 | Bacteria | 4634 |
| 77 | Ga0123355_10047896 | 3300009826 | Bacteria | 6948 |
| 78 | Ga0123356_10942665 | 3300010049 | Bacteria | 1034 |
| 79 | Ga0123353_10304634 | 3300010167 | Bacteria | 2429 |
| 80 | Ga0123353_11415918 | 3300010167 | Bacteria | 892 |
| 81 | Ga0466729_214395 | 3300042621 | Bacteria | 14460 |
| 82 | Ga0466735_120936 | 3300042624 | Bacteria | 1390 |
| 83 | Ga0466704_172769 | 3300042643 | Unclassified | 5323 |
| 84 | Ga0466704_290242 | 3300042643 | Bacteria | 80372 |
| 85 | IMNBL1DRAFT_c0049672 | 3300000062 | Bacteria | 1336 |
| 86 | JGI24702J35022_10000940 | 3300002462 | Bacteria | 18193 |
| 87 | Ga0466714_128393 | 3300042603 | Bacteria | 1958 |
| 88 | Ga0466705_130594 | 3300042612 | Bacteria | 3254 |
| 89 | Ga0466705_357248 | 3300042612 | Unclassified | 4613 |
| 90 | Ga0466733_021163 | 3300042659 | Bacteria | 1611 |
| 91 | Ga0466711_400276 | 3300042615 | Bacteria | 4398 |
| 92 | Ga0123355_10001425 | 3300009826 | Bacteria | 33346 |
| 93 | Ga0123353_10200561 | 3300010167 | Bacteria | 3139 |
| 94 | Ga0123353_11512598 | 3300010167 | Bacteria | 854 |
| 95 | Ga0123354_10119903 | 3300010882 | Bacteria | 3405 |
| 96 | Ga0103268_1001518 | 3300007192 | Bacteria | 5711 |
| 97 | Ga0415639_008908 | 3300038395 | Bacteria | 5078 |
| 98 | Ga0415639_197594 | 3300038395 | Bacteria | 3702 |
| 99 | Ga0466691_045322 | 3300042593 | Bacteria | 1969 |
| 100 | Ga0466691_102603 | 3300042593 | Bacteria | 9512 |
| 101 | Ga0466696_052856 | 3300042596 | Bacteria | 3017 |
| 102 | Ga0466723_258862 | 3300042618 | Bacteria | 3052 |
| 103 | Ga0123355_10734051 | 3300009826 | Unclassified | 1122 |
| 104 | Ga0123356_10552397 | 3300010049 | Bacteria | 1313 |
| 105 | Ga0123356_10598672 | 3300010049 | Bacteria | 1267 |
| 106 | Ga0123353_10089700 | 3300010167 | Bacteria | 4950 |
| 107 | Ga0123353_10207661 | 3300010167 | Bacteria | 3074 |
| 108 | Ga0123353_10914893 | 3300010167 | Bacteria | 1192 |
| 109 | Ga0466702_259944 | 3300042635 | Bacteria | 1058 |
| 110 | Ga0466704_319165 | 3300042643 | Bacteria | 2380 |
| 111 | Ga0072941_1062691 | 3300005201 | Bacteria | 2366 |
| 112 | Ga0466706_124535 | 3300042599 | Bacteria | 36210 |
| 113 | Ga0466707_011173 | 3300042601 | Bacteria | 3630 |
| 114 | Ga0466707_084123 | 3300042601 | Bacteria | 2966 |
| 115 | Ga0466717_155800 | 3300042604 | Bacteria | 1401 |
| 116 | Ga0466717_236430 | 3300042604 | Bacteria | 1253 |
| 117 | Ga0466716_416852 | 3300042605 | Bacteria | 1272 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042616 | Ga0466715_468588 | Ga0466715_468588_1777_2325 | 182 |
| 2 | 3300042599 | Ga0466706_280834 | Ga0466706_280834_44505_45083 | 192 |
| 3 | 3300042636 | Ga0466703_075893 | Ga0466703_075893_3206_3784 | 192 |
| 4 | 3300005071 | Ga0068302_10052272 | Ga0068302_100522722 | 194 |
| 5 | 3300042615 | Ga0466711_044975 | Ga0466711_044975_550_1134 | 194 |
| 6 | 3300042612 | Ga0466705_258880 | Ga0466705_258880_101_691 | 196 |
| 7 | 3300042612 | Ga0466705_062246 | Ga0466705_062246_7056_7652 | 198 |
| 8 | 3300042604 | Ga0466717_225702 | Ga0466717_225702_446_1045 | 199 |
| 9 | 3300042604 | Ga0466717_236430 | Ga0466717_236430_473_1072 | 199 |
| 10 | 3300042592 | Ga0466693_189479 | Ga0466693_189479_44129_44734 | 201 |
| 11 | 3300042612 | Ga0466705_254472 | Ga0466705_254472_3770_4375 | 201 |
| 12 | 3300042616 | Ga0466715_373542 | Ga0466715_373542_777_1382 | 201 |
| 13 | 3300042618 | Ga0466723_320347 | Ga0466723_320347_2049_2654 | 201 |
| 14 | 3300042635 | Ga0466702_433032 | Ga0466702_433032_535_1140 | 201 |
| 15 | 3300010049 | Ga0123356_10598672 | Ga0123356_105986722 | 202 |
| 16 | 3300042636 | Ga0466703_349595 | Ga0466703_349595_2604_3212 | 202 |
| 17 | 3300042643 | Ga0466704_184409 | Ga0466704_184409_91278_91886 | 202 |
| 18 | 3300009784 | Ga0123357_10000772 | Ga0123357_1000077215 | 203 |
| 19 | 3300042599 | Ga0466706_123406 | Ga0466706_123406_11059_11670 | 203 |
| 20 | 3300002462 | JGI24702J35022_10000940 | JGI24702J35022_100009403 | 204 |
| 21 | 3300042609 | Ga0466722_233627 | Ga0466722_233627_184_798 | 204 |
| 22 | 3300042635 | Ga0466702_104720 | Ga0466702_104720_1684_2319 | 204 |
| 23 | 3300042635 | Ga0466702_134939 | Ga0466702_134939_66_680 | 204 |
| 24 | 3300005071 | Ga0068302_10088034 | Ga0068302_100880343 | 205 |
| 25 | 3300042593 | Ga0466691_102603 | Ga0466691_102603_5083_5700 | 205 |
| 26 | 3300042617 | Ga0466718_038505 | Ga0466718_038505_276_893 | 205 |
| 27 | 3300042636 | Ga0466703_360789 | Ga0466703_360789_464_1081 | 205 |
| 28 | 3300042659 | Ga0466733_021163 | Ga0466733_021163_490_1107 | 205 |
| 29 | 3300042596 | Ga0466696_252438 | Ga0466696_252438_386_1006 | 206 |
| 30 | 3300042599 | Ga0466706_124535 | Ga0466706_124535_12115_12735 | 206 |
| 31 | 3300042612 | Ga0466705_218107 | Ga0466705_218107_9852_10472 | 206 |
| 32 | 3300042612 | Ga0466705_350180 | Ga0466705_350180_36602_37222 | 206 |
| 33 | 3300042612 | Ga0466705_357248 | Ga0466705_357248_2825_3445 | 206 |
| 34 | 3300042612 | Ga0466705_397621 | Ga0466705_397621_18_638 | 206 |
| 35 | 3300042620 | Ga0466728_464326 | Ga0466728_464326_305_925 | 206 |
| 36 | 3300042643 | Ga0466704_319165 | Ga0466704_319165_673_1293 | 206 |
| 37 | 3300005201 | Ga0072941_1143880 | Ga0072941_11438802 | 207 |
| 38 | 3300042591 | Ga0466692_047586 | Ga0466692_047586_367_990 | 207 |
| 39 | 3300042621 | Ga0466729_214395 | Ga0466729_214395_12102_12725 | 207 |
| 40 | 3300042635 | Ga0466702_259944 | Ga0466702_259944_199_822 | 207 |
| 41 | 3300000089 | AustNasuHG_c1044157 | AustNasuHG_10441572 | 208 |
| 42 | 3300010167 | Ga0123353_10089700 | Ga0123353_100897004 | 208 |
| 43 | 3300010167 | Ga0123353_10207661 | Ga0123353_102076613 | 208 |
| 44 | 3300042593 | Ga0466691_090473 | Ga0466691_090473_1465_2091 | 208 |
| 45 | 3300042619 | Ga0466726_469424 | Ga0466726_469424_3193_3819 | 208 |
| 46 | 3300042635 | Ga0466702_396991 | Ga0466702_396991_368_994 | 208 |
| 47 | 3300000089 | AustNasuHG_c1013093 | AustNasuHG_10130934 | 209 |
| 48 | 3300010049 | Ga0123356_10002883 | Ga0123356_1000288318 | 209 |
| 49 | 3300010167 | Ga0123353_10200561 | Ga0123353_102005615 | 209 |
| 50 | 3300010167 | Ga0123353_10215475 | Ga0123353_102154752 | 209 |
| 51 | 3300010167 | Ga0123353_10301666 | Ga0123353_103016662 | 209 |
| 52 | 3300010167 | Ga0123353_10304634 | Ga0123353_103046343 | 209 |
| 53 | 3300010167 | Ga0123353_11415918 | Ga0123353_114159182 | 209 |
| 54 | 3300010167 | Ga0123353_11512598 | Ga0123353_115125981 | 209 |
| 55 | 3300038395 | Ga0415639_008908 | Ga0415639_008908_2766_3395 | 209 |
| 56 | 3300038395 | Ga0415639_041058 | Ga0415639_041058_2919_3548 | 209 |
| 57 | 3300038395 | Ga0415639_197594 | Ga0415639_197594_1986_2615 | 209 |
| 58 | 3300042601 | Ga0466707_011173 | Ga0466707_011173_1985_2614 | 209 |
| 59 | 3300042604 | Ga0466717_155800 | Ga0466717_155800_513_1142 | 209 |
| 60 | 3300042608 | Ga0466721_167518 | Ga0466721_167518_431_1060 | 209 |
| 61 | 3300042611 | Ga0466697_051618 | Ga0466697_051618_1749_2378 | 209 |
| 62 | 3300042612 | Ga0466705_130594 | Ga0466705_130594_2171_2800 | 209 |
| 63 | 3300042615 | Ga0466711_400276 | Ga0466711_400276_3505_4134 | 209 |
| 64 | 3300042618 | Ga0466723_093620 | Ga0466723_093620_625_1254 | 209 |
| 65 | 3300042643 | Ga0466704_172769 | Ga0466704_172769_1536_2165 | 209 |
| 66 | 3300042643 | Ga0466704_290242 | Ga0466704_290242_74264_74893 | 209 |
| 67 | 3300009826 | Ga0123355_10043580 | Ga0123355_100435802 | 210 |
| 68 | 3300009826 | Ga0123355_10230497 | Ga0123355_102304973 | 210 |
| 69 | 3300042603 | Ga0466714_031718 | Ga0466714_031718_1780_2412 | 210 |
| 70 | 3300042603 | Ga0466714_128393 | Ga0466714_128393_40_672 | 210 |
| 71 | 3300042612 | Ga0466705_055438 | Ga0466705_055438_17915_18547 | 210 |
| 72 | 3300042612 | Ga0466705_238482 | Ga0466705_238482_132_764 | 210 |
| 73 | 3300042619 | Ga0466726_246675 | Ga0466726_246675_1656_2288 | 210 |
| 74 | 3300042624 | Ga0466735_120936 | Ga0466735_120936_173_805 | 210 |
| 75 | 3300007192 | Ga0103268_1001518 | Ga0103268_10015185 | 211 |
| 76 | 3300009826 | Ga0123355_10001425 | Ga0123355_1000142519 | 211 |
| 77 | 3300010049 | Ga0123356_10552397 | Ga0123356_105523972 | 211 |
| 78 | 3300010167 | Ga0123353_10409305 | Ga0123353_104093052 | 211 |
| 79 | 3300042616 | Ga0466715_149184 | Ga0466715_149184_4507_5142 | 211 |
| 80 | 3300042636 | Ga0466703_198272 | Ga0466703_198272_47_682 | 211 |
| 81 | 3300005200 | Ga0072940_1095149 | Ga0072940_10951493 | 212 |
| 82 | 3300009826 | Ga0123355_10312620 | Ga0123355_103126204 | 212 |
| 83 | 3300024493 | Ga0264413_146491 | Ga0264413_1464913 | 212 |
| 84 | 3300042593 | Ga0466691_045322 | Ga0466691_045322_104_742 | 212 |
| 85 | 3300042596 | Ga0466696_052856 | Ga0466696_052856_1252_1890 | 212 |
| 86 | 3300042599 | Ga0466706_019635 | Ga0466706_019635_6439_7077 | 212 |
| 87 | 3300042616 | Ga0466715_270979 | Ga0466715_270979_943_1581 | 212 |
| 88 | 3300042618 | Ga0466723_258862 | Ga0466723_258862_491_1129 | 212 |
| 89 | 3300042619 | Ga0466726_068422 | Ga0466726_068422_761_1399 | 212 |
| 90 | 3300042619 | Ga0466726_201784 | Ga0466726_201784_1431_2069 | 212 |
| 91 | 3300042619 | Ga0466726_397243 | Ga0466726_397243_2256_2894 | 212 |
| 92 | 3300042636 | Ga0466703_125033 | Ga0466703_125033_625_1263 | 212 |
| 93 | 3300042652 | Ga0466708_109343 | Ga0466708_109343_346_984 | 212 |
| 94 | 3300009826 | Ga0123355_10047896 | Ga0123355_100478969 | 213 |
| 95 | 3300009826 | Ga0123355_10734051 | Ga0123355_107340511 | 213 |
| 96 | 3300010882 | Ga0123354_10119903 | Ga0123354_101199035 | 213 |
| 97 | 3300042616 | Ga0466715_321032 | Ga0466715_321032_153090_153731 | 213 |
| 98 | 3300042619 | Ga0466726_124252 | Ga0466726_124252_8479_9120 | 213 |
| 99 | 3300000062 | IMNBL1DRAFT_c0049672 | IMNBL1DRAFT_00496722 | 214 |
| 100 | 3300010049 | Ga0123356_10942665 | Ga0123356_109426651 | 214 |
| 101 | 3300010167 | Ga0123353_10461863 | Ga0123353_104618632 | 214 |
| 102 | 3300042612 | Ga0466705_070696 | Ga0466705_070696_7516_8160 | 214 |
| 103 | 3300042616 | Ga0466715_194201 | Ga0466715_194201_69703_70347 | 214 |
| 104 | 3300042617 | Ga0466718_122099 | Ga0466718_122099_375_1019 | 214 |
| 105 | 3300042605 | Ga0466716_416852 | Ga0466716_416852_594_1241 | 215 |
| 106 | 3300010049 | Ga0123356_10070098 | Ga0123356_100700983 | 216 |
| 107 | 3300042599 | Ga0466706_094043 | Ga0466706_094043_2378_3028 | 216 |
| 108 | 3300042615 | Ga0466711_165246 | Ga0466711_165246_1136_1786 | 216 |
| 109 | 3300042601 | Ga0466707_084123 | Ga0466707_084123_1727_2380 | 217 |
| 110 | 3300042601 | Ga0466707_129075 | Ga0466707_129075_27673_28326 | 217 |
| 111 | 3300002931 | CVPL010W_10000817 | CVPL010W_1000081731 | 218 |
| 112 | 3300005201 | Ga0072941_1062691 | Ga0072941_10626912 | 218 |
| 113 | 3300010167 | Ga0123353_10914893 | Ga0123353_109148932 | 218 |
| 114 | 3300010167 | Ga0123353_11185545 | Ga0123353_111855452 | 218 |
| 115 | 3300042603 | Ga0466714_129695 | Ga0466714_129695_9175_9840 | 221 |
| 116 | 3300042615 | Ga0466711_393032 | Ga0466711_393032_27_698 | 223 |
| 117 | 3300042619 | Ga0466726_077664 | Ga0466726_077664_2537_3208 | 223 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09517 | RE_Eco29kI | Eco29kI restriction endonuclease | 41 | 204 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.