Protein Family IF07555

Metagenome Isolate
240 Members
85 Samples
213 Scaffolds
263.91 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_366859|Ga0466711_366859_194_1165
Length
323 aa
Sequence
MKEMKRGSNASAFYFKTALLDGCSPEIIILMYRKTVYNCFFFYFCSVETDSKNRKSMKLTIIGAGNMGGAIARGLANSAAVKASDIICSDCAKEALDKIRMTNPAIRTTSDNGEAVKNADIVLLAVKPWLLETVLAEIKSGLDYKRQIIISIVAGVTFAQLKEWLGSDAETAPVLFRLIPNTAIDVQNSMTFISSQNATPEQTGLIVSIFDELGTTLLVEERLMAAGTALASCGIAYAFRYIRAAMEGGVELGFYPEQAKNIVLQTLKGAVALLQANGTHPEAEIDKVSTPGGITIRGLNEMEHAGFTSAVIRGLKASKLNDV

📊 Sample Types

Isolate 11.2%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.6%
Blattidae 20.5%
Kalotermitidae 17.9%
Unclassified 9.0%
Culicidae 5.1%
Rhinotermitidae 5.1%
Termopsidae 5.1%
Passalidae 3.8%
Armadillidiidae 1.3%
Hodotermitidae 1.3%
Bombycidae 1.3%
Tenebrionidae 1.3%
Drosophilidae 1.3%
Hydrophilidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 237
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
4 2923982719 Parabacteroides sp. 52 Isolate Blattidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
10 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2896350215 Sphingobacterium sp. xlx-183 Isolate
18 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
19 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
20 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
21 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
22 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
29 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
30 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
33 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
36 2898741527 Sphingobacterium sp. xlx-73 Isolate
37 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
38 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
39 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
40 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
51 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
52 2896330536 Sphingobacterium sp. xlx-96 Isolate
53 2920168565 Paludibacter sp. 221 Isolate Blattidae
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
56 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
57 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
58 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
59 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
60 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
61 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
62 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
63 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 2896321640 Sphingobacterium sp. xlx-130 Isolate
67 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
68 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
69 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
70 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
71 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
72 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
73 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
74 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
75 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
76 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
77 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
78 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
79 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
80 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
81 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
82 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
83 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
84 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
85 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_075052 3300042600 Bacteria 2331
2 Ga0466707_015457 3300042601 Bacteria 6358
3 Ga0466707_272109 3300042601 Bacteria 19065
4 Ga0466713_043748 3300042602 Bacteria 36134
5 Ga0466713_115233 3300042602 Bacteria 28611
6 Ga0466713_129702 3300042602 Unclassified 4351
7 Ga0466719_092583 3300042606 Bacteria 6411
8 Ga0466719_253553 3300042606 Bacteria 9442
9 Ga0123357_10007548 3300009784 Bacteria 13455
10 Ga0123355_10269650 3300009826 Bacteria 2367
11 Ga0123356_10041702 3300010049 Bacteria 4277
12 Ga0123353_10159923 3300010167 Bacteria 3587
13 Ga0123353_10336736 3300010167 Bacteria 2281
14 Ga0466729_297224 3300042621 Bacteria 7158
15 Ga0466735_057917 3300042624 Bacteria 2500
16 Ga0466703_352062 3300042636 Bacteria 6366
17 Ga0466708_299188 3300042652 Bacteria 34210
18 Ga0466708_330262 3300042652 Bacteria 27220
19 Ga0466726_486459 3300042619 Bacteria 4753
20 Ga0160459_100019 3300012831 Bacteria 370950
21 Ga0160446_100016 3300012835 Bacteria 260119
22 Ga0466691_003484 3300042593 Bacteria 5216
23 Ga0466691_205633 3300042593 Bacteria 5522
24 JGI24702J35022_10003394 3300002462 Bacteria 9609
25 JGI24699J35502_11133056 3300002509 Bacteria 8477
26 Ga0466706_063433 3300042599 Bacteria 14673
27 Ga0466706_120308 3300042599 Bacteria 17593
28 Ga0466700_029154 3300042600 Bacteria 1830
29 Ga0466707_131352 3300042601 Bacteria 11891
30 Ga0466713_150677 3300042602 Bacteria 11132
31 Ga0466714_001728 3300042603 Bacteria 35313
32 Ga0466716_173848 3300042605 Bacteria 43531
33 Ga0466719_570336 3300042606 Bacteria 5834
34 Ga0123354_10110430 3300010882 Bacteria 3636
35 Ga0466735_217933 3300042624 Bacteria 2066
36 Ga0466703_094378 3300042636 Bacteria 5881
37 Ga0466703_402195 3300042636 Bacteria 11707
38 Ga0466708_053809 3300042652 Bacteria 1101
39 Ga0466715_071107 3300042616 Bacteria 1684
40 Ga0466715_606131 3300042616 Bacteria 2425
41 Ga0466723_105125 3300042618 Bacteria 7881
42 Ga0160467_100158 3300012829 Bacteria 94072
43 Ga0466691_044824 3300042593 Bacteria 13767
44 2227219686 2225789004 Bacteria 32839
45 JGI24705J35276_12163163 3300002504 Bacteria 1244
46 JGI24699J35502_11134161 3300002509 Bacteria 40857
47 Ga0466705_007790 3300042612 Bacteria 8233
48 Ga0466706_005029 3300042599 Bacteria 45009
49 Ga0466706_011822 3300042599 Bacteria 3780
50 Ga0466700_410010 3300042600 Bacteria 5204
51 Ga0466707_283024 3300042601 Bacteria 2096
52 Ga0466707_305021 3300042601 Bacteria 4646
53 Ga0466713_098989 3300042602 Bacteria 18122
54 Ga0466714_132771 3300042603 Bacteria 10274
55 Ga0466716_516457 3300042605 Bacteria 2142
56 Ga0466719_313295 3300042606 Bacteria 15821
57 Ga0466722_139992 3300042609 Bacteria 10006
58 Ga0123356_10638982 3300010049 Bacteria 1231
59 Ga0123356_10653471 3300010049 Bacteria 1219
60 Ga0466734_016795 3300042623 Bacteria 2656
61 Ga0466703_149168 3300042636 Bacteria 2403
62 Ga0466703_369378 3300042636 Bacteria 6331
63 Ga0466704_044947 3300042643 Bacteria 37107
64 Ga0466709_219887 3300042648 Bacteria 10648
65 Ga0466709_316559 3300042648 Bacteria 7987
66 Ga0466708_106426 3300042652 Bacteria 8038
67 Ga0466727_319003 3300042655 Bacteria 50861
68 Ga0466715_007240 3300042616 Bacteria 11575
69 Ga0466715_130115 3300042616 Bacteria 7059
70 Ga0466715_211244 3300042616 Bacteria 22087
71 Ga0466723_006875 3300042618 Bacteria 5918
72 Ga0466723_047670 3300042618 Bacteria 16534
73 Ga0466728_324049 3300042620 Bacteria 45950
74 Ga0160472_105391 3300012839 Bacteria 2062
75 Ga0466690_043642 3300042590 Bacteria 11167
76 Ga0466692_008206 3300042591 Bacteria 1921
77 Ga0466692_049252 3300042591 Bacteria 14960
78 Ga0466697_239906 3300042611 Bacteria 2495
79 Ga0466705_119612 3300042612 Bacteria 8501
80 Ga0466705_289968 3300042612 Bacteria 1304
81 Ga0466733_055750 3300042659 Bacteria 12185
82 Ga0466733_113500 3300042659 Bacteria 62412
83 Ga0466733_160784 3300042659 Bacteria 34990
84 Ga0466733_162069 3300042659 Bacteria 4922
85 Ga0466707_309001 3300042601 Bacteria 34578
86 Ga0466713_044092 3300042602 Bacteria 37791
87 Ga0466713_128381 3300042602 Bacteria 2030
88 Ga0466719_082083 3300042606 Bacteria 1823
89 Ga0466719_313973 3300042606 Bacteria 4171
90 Ga0123356_10164701 3300010049 Bacteria 2220
91 Ga0123354_10026653 3300010882 Bacteria 9117
92 Ga0466729_242318 3300042621 Bacteria 5121
93 Ga0466731_205555 3300042622 Bacteria 1227
94 Ga0466735_023729 3300042624 Bacteria 7648
95 Ga0466735_221859 3300042624 Bacteria 3793
96 Ga0466703_164473 3300042636 Bacteria 10682
97 Ga0466703_231193 3300042636 Bacteria 14508
98 Ga0466725_064564 3300042654 Bacteria 23138
99 Ga0466727_061548 3300042655 Bacteria 36764
100 Ga0466727_140607 3300042655 Bacteria 6995
101 Ga0466727_328225 3300042655 Bacteria 15670
102 Ga0466711_195085 3300042615 Bacteria 4101
103 Ga0466711_255641 3300042615 Bacteria 5718
104 Ga0466715_102786 3300042616 Bacteria 21811
105 Ga0466715_494181 3300042616 Bacteria 14789
106 Ga0466728_250780 3300042620 Bacteria 8539
107 Ga0160460_100045 3300012845 Bacteria 232961
108 Ga0466690_027402 3300042590 Bacteria 10228
109 Ga0466693_035956 3300042592 Bacteria 1040
110 Ga0466696_368481 3300042596 Bacteria 12350
111 IMNBL1DRAFT_c0019730 3300000062 Bacteria 2752
112 Ga0466705_255468 3300042612 Bacteria 9565
113 Ga0466733_011966 3300042659 Bacteria 8182
114 Ga0466701_076748 3300042598 Bacteria 2955
115 Ga0466706_013284 3300042599 Bacteria 22625
116 Ga0466706_135593 3300042599 Bacteria 13206
117 Ga0466719_560517 3300042606 Bacteria 3975
118 Ga0466722_074341 3300042609 Bacteria 7976
119 Ga0123357_10006387 3300009784 Bacteria 14365
120 Ga0466735_059475 3300042624 Bacteria 3292
121 Ga0466735_178913 3300042624 Bacteria 1271
122 Ga0466703_065073 3300042636 Bacteria 13959
123 Ga0466708_039792 3300042652 Bacteria 2187
124 Ga0466711_366859 3300042615 Bacteria 14957
125 Ga0466715_123845 3300042616 Bacteria 7555
126 Ga0466715_413404 3300042616 Bacteria 1982
127 Ga0466723_127060 3300042618 Bacteria 8635
128 Ga0466723_223232 3300042618 Bacteria 20243
129 Ga0466723_266166 3300042618 Bacteria 15213
130 Ga0466726_275675 3300042619 Bacteria 1359
131 Ga0466726_318326 3300042619 Bacteria 2684
132 Ga0466728_065940 3300042620 Bacteria 8129
133 Ga0466728_419189 3300042620 Bacteria 4039
134 Ga0466690_063672 3300042590 Bacteria 11801
135 Ga0466691_036539 3300042593 Bacteria 23739
136 Ga0466701_005522 3300042598 Bacteria 21003
137 JGI24702J35022_10019524 3300002462 Bacteria 3685
138 JGI24699J35502_11134000 3300002509 Bacteria 23716
139 Ga0068305_10021708 3300005083 Bacteria 17784
140 Ga0068305_10070469 3300005083 Bacteria 6582
141 Ga0466733_087347 3300042659 Bacteria 23276
142 Ga0466733_113177 3300042659 Bacteria 40710
143 Ga0562377_0004 3300056842 Bacteria 3525959
144 Ga0466713_060620 3300042602 Bacteria 398690
145 Ga0466722_124502 3300042609 Bacteria 7370
146 Ga0466722_253038 3300042609 Bacteria 7100
147 Ga0123357_10010550 3300009784 Bacteria 11764
148 Ga0123353_10095152 3300010167 Bacteria 4799
149 Ga0123354_10001008 3300010882 Bacteria 32139
150 Ga0123354_10020243 3300010882 Bacteria 10459
151 Ga0123354_10127934 3300010882 Bacteria 3230
152 Ga0123354_10196547 3300010882 Bacteria 2235
153 Ga0466703_078312 3300042636 Bacteria 6232
154 Ga0466704_227670 3300042643 Bacteria 14516
155 Ga0466704_340525 3300042643 Bacteria 5681
156 Ga0466708_138438 3300042652 Bacteria 9602
157 Ga0466727_161849 3300042655 Bacteria 5386
158 Ga0466710_215755 3300042613 Bacteria 1219
159 Ga0466723_355198 3300042618 Bacteria 25887
160 Ga0466728_446976 3300042620 Bacteria 5875
161 Ga0160453_100018 3300012814 Bacteria 253724
162 Ga0466694_009006 3300042594 Bacteria 3498
163 Ga0466696_160871 3300042596 Bacteria 1466
164 2227008145 2225789003 Bacteria 23710
165 IMNBL1DRAFT_c0000725 3300000062 Bacteria 26173
166 IMNBL1DRAFT_c0001423 3300000062 Bacteria 17909
167 JGI24702J35022_10005021 3300002462 Bacteria 7802
168 Ga0104045_1006711 3300007085 Bacteria 7567
169 Ga0466713_065595 3300042602 Bacteria 4349
170 Ga0466713_137678 3300042602 Bacteria 8821
171 Ga0466713_140874 3300042602 Bacteria 46073
172 Ga0466698_251581 3300042610 Unclassified 1461
173 Ga0123357_10268529 3300009784 Bacteria 1787
174 Ga0123353_10471395 3300010167 Bacteria 1841
175 Ga0123354_10107964 3300010882 Bacteria 3701
176 Ga0123354_10156391 3300010882 Bacteria 2732
177 Ga0160466_100006 3300012809 Bacteria 498369
178 Ga0466731_043486 3300042622 Bacteria 1001
179 Ga0466703_089142 3300042636 Bacteria 4900
180 Ga0466708_207180 3300042652 Bacteria 3661
181 Ga0466727_095447 3300042655 Bacteria 23337
182 Ga0466711_104116 3300042615 Bacteria 2733
183 Ga0466711_152133 3300042615 Bacteria 11698
184 Ga0466711_415360 3300042615 Bacteria 6131
185 Ga0466723_002914 3300042618 Bacteria 32279
186 Ga0466726_076425 3300042619 Bacteria 2029
187 Ga0466726_218744 3300042619 Bacteria 7727
188 Ga0466691_020889 3300042593 Bacteria 16573
189 JGI24699J35502_11134231 3300002509 Bacteria 105586
190 Ga0068302_10012537 3300005071 Unclassified 5560
191 Ga0123357_10000568 3300009784 Bacteria 36446
192 Ga0466705_224274 3300042612 Bacteria 5074
193 Ga0466733_105763 3300042659 Bacteria 12305
194 Ga0466706_138293 3300042599 Bacteria 60619
195 Ga0466700_158672 3300042600 Bacteria 66427
196 Ga0466707_090775 3300042601 Bacteria 1733
197 Ga0466707_370878 3300042601 Bacteria 5717
198 Ga0466713_041499 3300042602 Bacteria 101217
199 Ga0466713_061265 3300042602 Bacteria 21524
200 Ga0466716_036664 3300042605 Bacteria 4367
201 Ga0466716_093077 3300042605 Bacteria 2664
202 Ga0123354_10272904 3300010882 Bacteria 1660
203 Ga0466735_090943 3300042624 Bacteria 2406
204 Ga0466704_469671 3300042643 Bacteria 6741
205 Ga0466727_232992 3300042655 Bacteria 2924
206 Ga0466728_002447 3300042620 Bacteria 1704
207 Ga0466728_048266 3300042620 Bacteria 3527
208 Ga0466690_068273 3300042590 Bacteria 14721
209 Ga0466691_110838 3300042593 Bacteria 3525
210 IMNBL1DRAFT_c0000468 3300000062 Bacteria 33779
211 Ga0068305_10032150 3300005083 Bacteria 7165
212 Ga0068305_10797486 3300005083 Bacteria 1242
213 Ga0072941_1188180 3300005201 Bacteria 3234

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_048266 Ga0466728_048266_2876_3511 211
2 3300042636 Ga0466703_089142 Ga0466703_089142_386_1186 236
3 3300042593 Ga0466691_110838 Ga0466691_110838_1222_2013 239
4 3300042593 Ga0466691_020889 Ga0466691_020889_4041_4832 241
5 3300042620 Ga0466728_419189 Ga0466728_419189_2425_3216 241
6 3300042636 Ga0466703_369378 Ga0466703_369378_2986_3777 243
7 3300042616 Ga0466715_071107 Ga0466715_071107_252_1043 244
8 3300042618 Ga0466723_047670 Ga0466723_047670_448_1239 246
9 3300042593 Ga0466691_003484 Ga0466691_003484_3298_4089 247
10 3300042618 Ga0466723_266166 Ga0466723_266166_7160_7951 249
11 3300042655 Ga0466727_140607 Ga0466727_140607_4354_5145 249
12 3300042615 Ga0466711_415360 Ga0466711_415360_60_851 250
13 3300042652 Ga0466708_138438 Ga0466708_138438_3684_4475 250
14 3300012831 Ga0160459_100019 Ga0160459_100019143 252
15 3300012835 Ga0160446_100016 Ga0160446_100016145 252
16 3300042621 Ga0466729_297224 Ga0466729_297224_722_1507 252
17 3300042652 Ga0466708_039792 Ga0466708_039792_442_1233 253
18 3300042652 Ga0466708_053809 Ga0466708_053809_198_989 253
19 3300042615 Ga0466711_195085 Ga0466711_195085_1203_1970 255
20 3300042601 Ga0466707_090775 Ga0466707_090775_942_1712 256
21 3300042624 Ga0466735_059475 Ga0466735_059475_1186_1959 257
22 3300042648 Ga0466709_316559 Ga0466709_316559_463_1254 258
23 3300042601 Ga0466707_309001 Ga0466707_309001_25247_26026 259
24 3300042601 Ga0466707_370878 Ga0466707_370878_310_1089 259
25 3300042602 Ga0466713_060620 Ga0466713_060620_40107_40886 259
26 3300042612 Ga0466705_224274 Ga0466705_224274_514_1293 259
27 3300042616 Ga0466715_007240 Ga0466715_007240_6702_7481 259
28 3300042618 Ga0466723_355198 Ga0466723_355198_21090_21869 259
29 3300042624 Ga0466735_090943 Ga0466735_090943_340_1119 259
30 3300042643 Ga0466704_469671 Ga0466704_469671_146_925 259
31 3300042659 Ga0466733_162069 Ga0466733_162069_3756_4535 259
32 iso_pr_bacteria 2695420931 2698110437 259
33 3300042602 Ga0466713_041499 Ga0466713_041499_59035_59817 260
34 3300042602 Ga0466713_129702 Ga0466713_129702_2061_2843 260
35 3300042612 Ga0466705_289968 Ga0466705_289968_233_1015 260
36 3300042619 Ga0466726_318326 Ga0466726_318326_325_1107 260
37 3300042659 Ga0466733_055750 Ga0466733_055750_11157_11939 260
38 3300042659 Ga0466733_160784 Ga0466733_160784_12934_13716 260
39 3300056842 Ga0562377_0004 Ga0562377_0004_1293314_1294096 260
40 2225789003 2227008145 2227365256 261
41 2225789004 2227219686 2227652000 261
42 3300010049 Ga0123356_10164701 Ga0123356_101647012 261
43 3300010167 Ga0123353_10159923 Ga0123353_101599232 261
44 3300010167 Ga0123353_10336736 Ga0123353_103367362 261
45 3300012809 Ga0160466_100006 Ga0160466_100006380 261
46 3300012829 Ga0160467_100158 Ga0160467_1001587 261
47 3300042596 Ga0466696_160871 Ga0466696_160871_319_1104 261
48 3300042601 Ga0466707_131352 Ga0466707_131352_5397_6182 261
49 3300042602 Ga0466713_137678 Ga0466713_137678_2293_3078 261
50 3300042602 Ga0466713_140874 Ga0466713_140874_9428_10213 261
51 3300042603 Ga0466714_001728 Ga0466714_001728_3496_4281 261
52 3300042603 Ga0466714_132771 Ga0466714_132771_6796_7581 261
53 3300042615 Ga0466711_152133 Ga0466711_152133_3568_4353 261
54 3300042624 Ga0466735_023729 Ga0466735_023729_5520_6305 261
55 3300042636 Ga0466703_402195 Ga0466703_402195_3932_4717 261
56 3300042659 Ga0466733_087347 Ga0466733_087347_3451_4236 261
57 iso_pr_bacteria 2695420314 2695471168 261
58 iso_pr_bacteria 2910926975 2910929939 261
59 iso_pr_bacteria 2910942425 2910946039 261
60 iso_pr_bacteria 2910949487 2910952582 261
61 iso_pr_bacteria 2910959314 2910961501 261
62 iso_pr_bacteria 2940244548 2940247164 261
63 iso_pr_bacteria 2940248789 2940251142 261
64 iso_pr_bacteria 2940253009 2940255390 261
65 iso_pr_bacteria 2940257232 2940259387 261
66 iso_pr_bacteria 8100166142 8100168112 261
67 3300000062 IMNBL1DRAFT_c0000725 IMNBL1DRAFT_00007257 262
68 3300000062 IMNBL1DRAFT_c0001423 IMNBL1DRAFT_00014232 262
69 3300010167 Ga0123353_10095152 Ga0123353_100951523 262
70 3300042622 Ga0466731_043486 Ga0466731_043486_156_944 262
71 3300042636 Ga0466703_094378 Ga0466703_094378_1929_2717 262
72 3300042636 Ga0466703_149168 Ga0466703_149168_961_1749 262
73 3300009826 Ga0123355_10269650 Ga0123355_102696502 263
74 3300042590 Ga0466690_027402 Ga0466690_027402_4050_4841 263
75 3300042590 Ga0466690_063672 Ga0466690_063672_10866_11657 263
76 3300042590 Ga0466690_068273 Ga0466690_068273_2732_3523 263
77 3300042593 Ga0466691_044824 Ga0466691_044824_7576_8367 263
78 3300042601 Ga0466707_305021 Ga0466707_305021_1985_2776 263
79 3300042602 Ga0466713_098989 Ga0466713_098989_4473_5264 263
80 3300042602 Ga0466713_115233 Ga0466713_115233_11150_11941 263
81 3300042605 Ga0466716_093077 Ga0466716_093077_22_813 263
82 3300042605 Ga0466716_173848 Ga0466716_173848_17975_18766 263
83 3300042605 Ga0466716_516457 Ga0466716_516457_1243_2034 263
84 3300042606 Ga0466719_092583 Ga0466719_092583_2866_3657 263
85 3300042606 Ga0466719_253553 Ga0466719_253553_7785_8576 263
86 3300042609 Ga0466722_074341 Ga0466722_074341_4364_5155 263
87 3300042609 Ga0466722_253038 Ga0466722_253038_3224_4015 263
88 3300042612 Ga0466705_007790 Ga0466705_007790_2353_3144 263
89 3300042616 Ga0466715_102786 Ga0466715_102786_4403_5194 263
90 3300042616 Ga0466715_494181 Ga0466715_494181_11781_12572 263
91 3300042618 Ga0466723_002914 Ga0466723_002914_11206_11997 263
92 3300042618 Ga0466723_006875 Ga0466723_006875_1053_1844 263
93 3300042618 Ga0466723_105125 Ga0466723_105125_3311_4102 263
94 3300042619 Ga0466726_076425 Ga0466726_076425_990_1781 263
95 3300042619 Ga0466726_275675 Ga0466726_275675_391_1182 263
96 3300042620 Ga0466728_250780 Ga0466728_250780_5725_6516 263
97 3300042620 Ga0466728_324049 Ga0466728_324049_23886_24677 263
98 3300042620 Ga0466728_446976 Ga0466728_446976_387_1178 263
99 3300042622 Ga0466731_205555 Ga0466731_205555_97_888 263
100 3300042624 Ga0466735_057917 Ga0466735_057917_44_835 263
101 3300042624 Ga0466735_178913 Ga0466735_178913_132_923 263
102 3300042624 Ga0466735_221859 Ga0466735_221859_1899_2690 263
103 3300042643 Ga0466704_044947 Ga0466704_044947_23588_24379 263
104 3300042652 Ga0466708_299188 Ga0466708_299188_5698_6489 263
105 3300042655 Ga0466727_061548 Ga0466727_061548_35653_36444 263
106 3300042655 Ga0466727_095447 Ga0466727_095447_9658_10449 263
107 3300042655 Ga0466727_161849 Ga0466727_161849_4271_5062 263
108 3300042655 Ga0466727_328225 Ga0466727_328225_3968_4759 263
109 3300042659 Ga0466733_113177 Ga0466733_113177_16165_16956 263
110 3300042659 Ga0466733_113500 Ga0466733_113500_48850_49641 263
111 3300002462 JGI24702J35022_10003394 JGI24702J35022_100033942 264
112 3300002462 JGI24702J35022_10019524 JGI24702J35022_100195244 264
113 3300005083 Ga0068305_10021708 Ga0068305_100217085 264
114 3300005083 Ga0068305_10070469 Ga0068305_100704697 264
115 3300010049 Ga0123356_10638982 Ga0123356_106389822 264
116 3300042591 Ga0466692_008206 Ga0466692_008206_555_1349 264
117 3300042593 Ga0466691_205633 Ga0466691_205633_578_1372 264
118 3300042602 Ga0466713_061265 Ga0466713_061265_13041_13835 264
119 3300042605 Ga0466716_036664 Ga0466716_036664_2876_3670 264
120 3300042616 Ga0466715_123845 Ga0466715_123845_1078_1872 264
121 3300042636 Ga0466703_065073 Ga0466703_065073_11500_12294 264
122 3300042652 Ga0466708_106426 Ga0466708_106426_5334_6128 264
123 3300042652 Ga0466708_330262 Ga0466708_330262_20557_21351 264
124 3300042655 Ga0466727_232992 Ga0466727_232992_1557_2351 264
125 3300000062 IMNBL1DRAFT_c0000468 IMNBL1DRAFT_000046828 265
126 3300010167 Ga0123353_10471395 Ga0123353_104713952 265
127 3300042592 Ga0466693_035956 Ga0466693_035956_146_943 265
128 3300042594 Ga0466694_009006 Ga0466694_009006_721_1518 265
129 3300042596 Ga0466696_368481 Ga0466696_368481_10844_11641 265
130 3300042598 Ga0466701_005522 Ga0466701_005522_1806_2603 265
131 3300042598 Ga0466701_076748 Ga0466701_076748_1302_2099 265
132 3300042600 Ga0466700_158672 Ga0466700_158672_8207_9004 265
133 3300042600 Ga0466700_410010 Ga0466700_410010_4155_4952 265
134 3300042601 Ga0466707_272109 Ga0466707_272109_4247_5044 265
135 3300042606 Ga0466719_082083 Ga0466719_082083_37_834 265
136 3300042609 Ga0466722_124502 Ga0466722_124502_3256_4053 265
137 3300042610 Ga0466698_251581 Ga0466698_251581_438_1235 265
138 3300042611 Ga0466697_239906 Ga0466697_239906_259_1056 265
139 3300042613 Ga0466710_215755 Ga0466710_215755_252_1049 265
140 3300042618 Ga0466723_223232 Ga0466723_223232_17394_18191 265
141 iso_pr_bacteria 2820759988 2820761387 265
142 3300002462 JGI24702J35022_10005021 JGI24702J35022_100050214 266
143 3300002504 JGI24705J35276_12163163 JGI24705J35276_121631632 266
144 3300002509 JGI24699J35502_11133056 JGI24699J35502_111330564 266
145 3300002509 JGI24699J35502_11134000 JGI24699J35502_111340007 266
146 3300005083 Ga0068305_10032150 Ga0068305_100321505 266
147 3300005201 Ga0072941_1188180 Ga0072941_11881802 266
148 3300009784 Ga0123357_10000568 Ga0123357_100005684 266
149 3300009784 Ga0123357_10006387 Ga0123357_1000638716 266
150 3300009784 Ga0123357_10007548 Ga0123357_100075486 266
151 3300009784 Ga0123357_10010550 Ga0123357_100105502 266
152 3300010049 Ga0123356_10653471 Ga0123356_106534712 266
153 3300010882 Ga0123354_10001008 Ga0123354_100010086 266
154 3300010882 Ga0123354_10020243 Ga0123354_100202436 266
155 3300010882 Ga0123354_10026653 Ga0123354_100266533 266
156 3300010882 Ga0123354_10107964 Ga0123354_101079642 266
157 3300010882 Ga0123354_10110430 Ga0123354_101104302 266
158 3300010882 Ga0123354_10127934 Ga0123354_101279343 266
159 3300010882 Ga0123354_10156391 Ga0123354_101563911 266
160 3300010882 Ga0123354_10196547 Ga0123354_101965471 266
161 3300010882 Ga0123354_10272904 Ga0123354_102729042 266
162 3300042591 Ga0466692_049252 Ga0466692_049252_8980_9780 266
163 3300042593 Ga0466691_036539 Ga0466691_036539_13428_14228 266
164 3300042599 Ga0466706_005029 Ga0466706_005029_3147_3947 266
165 3300042599 Ga0466706_011822 Ga0466706_011822_1922_2722 266
166 3300042599 Ga0466706_013284 Ga0466706_013284_933_1733 266
167 3300042599 Ga0466706_063433 Ga0466706_063433_3724_4524 266
168 3300042599 Ga0466706_120308 Ga0466706_120308_10187_10987 266
169 3300042599 Ga0466706_135593 Ga0466706_135593_6629_7429 266
170 3300042599 Ga0466706_138293 Ga0466706_138293_2972_3772 266
171 3300042600 Ga0466700_075052 Ga0466700_075052_222_1022 266
172 3300042602 Ga0466713_043748 Ga0466713_043748_24820_25620 266
173 3300042602 Ga0466713_044092 Ga0466713_044092_30982_31782 266
174 3300042602 Ga0466713_150677 Ga0466713_150677_3502_4302 266
175 3300042606 Ga0466719_313295 Ga0466719_313295_638_1438 266
176 3300042609 Ga0466722_139992 Ga0466722_139992_7760_8560 266
177 3300042616 Ga0466715_130115 Ga0466715_130115_4468_5268 266
178 3300042616 Ga0466715_211244 Ga0466715_211244_32_832 266
179 3300042616 Ga0466715_413404 Ga0466715_413404_234_1034 266
180 3300042618 Ga0466723_127060 Ga0466723_127060_2866_3666 266
181 3300042619 Ga0466726_218744 Ga0466726_218744_4119_4919 266
182 3300042621 Ga0466729_242318 Ga0466729_242318_587_1387 266
183 3300042624 Ga0466735_217933 Ga0466735_217933_302_1102 266
184 3300042636 Ga0466703_352062 Ga0466703_352062_4396_5196 266
185 3300042655 Ga0466727_319003 Ga0466727_319003_22817_23617 266
186 iso_pr_bacteria 2579779088 2582239311 266
187 iso_pr_bacteria 2896321640 2896323916 266
188 iso_pr_bacteria 2896330536 2896332485 266
189 iso_pr_bacteria 2896350215 2896352297 266
190 iso_pr_bacteria 2898741527 2898744301 266
191 iso_pr_bacteria 2940199050 2940200216 266
192 iso_pr_bacteria 2940209341 2940209466 266
193 iso_pr_bacteria 2940346213 2940347833 266
194 3300005083 Ga0068305_10797486 Ga0068305_107974861 267
195 3300007085 Ga0104045_1006711 Ga0104045_10067117 267
196 3300009784 Ga0123357_10268529 Ga0123357_102685292 267
197 3300042600 Ga0466700_029154 Ga0466700_029154_343_1146 267
198 3300042602 Ga0466713_065595 Ga0466713_065595_285_1088 267
199 3300042636 Ga0466703_078312 Ga0466703_078312_573_1376 267
200 3300042652 Ga0466708_207180 Ga0466708_207180_2539_3396 267
201 iso_pr_bacteria 2820762746 2820765126 267
202 iso_pr_bacteria 2923982719 2923983133 267
203 iso_pr_bacteria 2940202316 2940204803 267
204 iso_pr_bacteria 2940371297 2940373486 267
205 3300002509 JGI24699J35502_11134231 JGI24699J35502_1113423123 268
206 3300042601 Ga0466707_015457 Ga0466707_015457_3312_4118 268
207 3300042606 Ga0466719_570336 Ga0466719_570336_3631_4437 268
208 3300042615 Ga0466711_104116 Ga0466711_104116_389_1195 268
209 3300042636 Ga0466703_164473 Ga0466703_164473_1997_2803 268
210 3300042643 Ga0466704_227670 Ga0466704_227670_4670_5476 268
211 3300042659 Ga0466733_011966 Ga0466733_011966_446_1252 268
212 3300042659 Ga0466733_105763 Ga0466733_105763_777_1583 268
213 iso_pr_bacteria 2920168565 2920170351 268
214 iso_pr_bacteria 2940195863 2940197654 268
215 3300000062 IMNBL1DRAFT_c0019730 IMNBL1DRAFT_00197303 269
216 3300042612 Ga0466705_119612 Ga0466705_119612_1400_2209 269
217 3300042619 Ga0466726_486459 Ga0466726_486459_2457_3266 269
218 iso_pr_bacteria 2873776654 2873778184 269
219 3300002509 JGI24699J35502_11134161 JGI24699J35502_1113416131 270
220 3300005071 Ga0068302_10012537 Ga0068302_100125372 270
221 3300042590 Ga0466690_043642 Ga0466690_043642_91_903 270
222 3300042602 Ga0466713_128381 Ga0466713_128381_1018_1830 270
223 3300042616 Ga0466715_606131 Ga0466715_606131_1221_2033 270
224 3300012814 Ga0160453_100018 Ga0160453_100018105 271
225 3300012839 Ga0160472_105391 Ga0160472_1053912 271
226 3300012845 Ga0160460_100045 Ga0160460_10004544 271
227 3300042612 Ga0466705_255468 Ga0466705_255468_3966_4781 271
228 3300042606 Ga0466719_560517 Ga0466719_560517_3125_3943 272
229 3300042654 Ga0466725_064564 Ga0466725_064564_16100_16918 272
230 3300042606 Ga0466719_313973 Ga0466719_313973_406_1263 277
231 3300042623 Ga0466734_016795 Ga0466734_016795_1396_2238 280
232 3300042601 Ga0466707_283024 Ga0466707_283024_490_1335 281
233 3300042620 Ga0466728_002447 Ga0466728_002447_83_934 283
234 3300042648 Ga0466709_219887 Ga0466709_219887_4351_5202 283
235 3300042643 Ga0466704_340525 Ga0466704_340525_2934_3788 284
236 3300010049 Ga0123356_10041702 Ga0123356_100417025 286
237 3300042620 Ga0466728_065940 Ga0466728_065940_3145_4008 287
238 3300042615 Ga0466711_255641 Ga0466711_255641_3331_4206 291
239 3300042636 Ga0466703_231193 Ga0466703_231193_9264_10172 302
240 3300042615 Ga0466711_366859 Ga0466711_366859_194_1165 323

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation 221 318 0.97
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 58 155 0.86
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 58 157 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.