Protein Family IF07541
Metagenome
Isolate
121
Members
50
Samples
114
Scaffolds
177.42
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_279510|Ga0466711_279510_3435_3986
- Length
- 167 aa
- Sequence
- MIFLQLFWVYIKIGMFNFGGGYAMLSLIQDEVVDRHQWITMQEFTDIVAISQMTPGPIGINSATYVGYTAVLNLAVCLPSLVLILIISYYYARFRKNRYVEAAFLGLRPTSVGLIAAAALLLMNESNFIDYKSFLLFAAAFLLTWKFKLHPILTIALAGLSGLLLYG
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.7%
Kalotermitidae
28.6%
Unclassified
8.2%
Blattidae
8.2%
Rhinotermitidae
6.1%
Termopsidae
6.1%
Passalidae
6.1%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 20 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 21 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 42 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 43 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_126817 | 3300042659 | Unclassified | 1571 |
| 2 | Ga0466690_167263 | 3300042590 | Bacteria | 25506 |
| 3 | Ga0466690_421533 | 3300042590 | Bacteria | 1358 |
| 4 | Ga0466692_016465 | 3300042591 | Bacteria | 61232 |
| 5 | Ga0466696_429349 | 3300042596 | Bacteria | 3343 |
| 6 | Ga0123357_10023869 | 3300009784 | Bacteria | 8224 |
| 7 | Ga0123357_10343707 | 3300009784 | Bacteria | 1439 |
| 8 | Ga0123353_11082934 | 3300010167 | Bacteria | 1066 |
| 9 | Ga0123354_10280084 | 3300010882 | Bacteria | 1621 |
| 10 | Ga0466711_117473 | 3300042615 | Bacteria | 12187 |
| 11 | Ga0466711_154202 | 3300042615 | Bacteria | 8920 |
| 12 | Ga0466711_296497 | 3300042615 | Bacteria | 19027 |
| 13 | Ga0466711_376634 | 3300042615 | Bacteria | 1108 |
| 14 | Ga0466723_293295 | 3300042618 | Bacteria | 2312 |
| 15 | Ga0466709_204440 | 3300042648 | Bacteria | 87623 |
| 16 | Ga0466708_204109 | 3300042652 | Bacteria | 11774 |
| 17 | Ga0466727_179323 | 3300042655 | Bacteria | 2079 |
| 18 | Ga0466716_046789 | 3300042605 | Bacteria | 8558 |
| 19 | Ga0466722_097084 | 3300042609 | Bacteria | 16830 |
| 20 | Ga0466722_132071 | 3300042609 | Bacteria | 17043 |
| 21 | Ga0466657_082786 | 3300042582 | Bacteria | 1673 |
| 22 | Ga0466690_254172 | 3300042590 | Bacteria | 86143 |
| 23 | Ga0466692_084947 | 3300042591 | Bacteria | 44846 |
| 24 | Ga0466723_030817 | 3300042618 | Bacteria | 11493 |
| 25 | Ga0466735_088271 | 3300042624 | Bacteria | 1331 |
| 26 | 2227047047 | 2225789003 | Unclassified | 3986 |
| 27 | IMNBL1DRAFT_c0002114 | 3300000062 | Bacteria | 14142 |
| 28 | JGI24699J35502_11134168 | 3300002509 | Bacteria | 43545 |
| 29 | Ga0466692_014618 | 3300042591 | Bacteria | 107882 |
| 30 | Ga0466694_028735 | 3300042594 | Bacteria | 1995 |
| 31 | Ga0123353_10183823 | 3300010167 | Bacteria | 3307 |
| 32 | Ga0123353_10201973 | 3300010167 | Bacteria | 3126 |
| 33 | Ga0466715_037009 | 3300042616 | Bacteria | 136739 |
| 34 | Ga0466702_058496 | 3300042635 | Bacteria | 1281 |
| 35 | Ga0466704_587040 | 3300042643 | Bacteria | 25925 |
| 36 | Ga0466722_109117 | 3300042609 | Bacteria | 10006 |
| 37 | Ga0466690_185181 | 3300042590 | Bacteria | 8143 |
| 38 | Ga0466692_092628 | 3300042591 | Bacteria | 22710 |
| 39 | Ga0466692_204059 | 3300042591 | Bacteria | 2158 |
| 40 | Ga0466691_159995 | 3300042593 | Bacteria | 9372 |
| 41 | Ga0466696_213422 | 3300042596 | Bacteria | 30084 |
| 42 | Ga0123356_10292724 | 3300010049 | Bacteria | 1729 |
| 43 | Ga0466711_279510 | 3300042615 | Bacteria | 6646 |
| 44 | Ga0466715_007427 | 3300042616 | Bacteria | 7637 |
| 45 | Ga0466726_057364 | 3300042619 | Bacteria | 17343 |
| 46 | Ga0466703_002887 | 3300042636 | Bacteria | 8699 |
| 47 | Ga0466698_426981 | 3300042610 | Bacteria | 1919 |
| 48 | 2227656587 | 2225789004 | Bacteria | 1970 |
| 49 | JGI24696J40584_12943910 | 3300002834 | Bacteria | 1792 |
| 50 | Ga0072941_1406816 | 3300005201 | Bacteria | 1363 |
| 51 | Ga0466705_191830 | 3300042612 | Bacteria | 21688 |
| 52 | Ga0466733_060357 | 3300042659 | Bacteria | 1172 |
| 53 | Ga0466694_057971 | 3300042594 | Bacteria | 1263 |
| 54 | Ga0466694_274940 | 3300042594 | Bacteria | 4436 |
| 55 | Ga0123357_10306385 | 3300009784 | Bacteria | 1594 |
| 56 | Ga0123356_10009226 | 3300010049 | Bacteria | 9750 |
| 57 | Ga0123353_10060571 | 3300010167 | Bacteria | 6070 |
| 58 | Ga0466710_041540 | 3300042613 | Bacteria | 1792 |
| 59 | Ga0466710_285493 | 3300042613 | Bacteria | 1403 |
| 60 | Ga0466715_079574 | 3300042616 | Bacteria | 30299 |
| 61 | Ga0466715_274089 | 3300042616 | Bacteria | 6351 |
| 62 | Ga0466715_410357 | 3300042616 | Bacteria | 12461 |
| 63 | Ga0466735_191831 | 3300042624 | Bacteria | 1534 |
| 64 | Ga0466703_310367 | 3300042636 | Bacteria | 3442 |
| 65 | Ga0466722_200813 | 3300042609 | Bacteria | 5286 |
| 66 | JGI24702J35022_10318550 | 3300002462 | Bacteria | 922 |
| 67 | Ga0466690_190126 | 3300042590 | Bacteria | 12776 |
| 68 | Ga0466690_286689 | 3300042590 | Bacteria | 4401 |
| 69 | Ga0466692_029223 | 3300042591 | Bacteria | 8166 |
| 70 | Ga0466694_041598 | 3300042594 | Bacteria | 2568 |
| 71 | Ga0123356_12944746 | 3300010049 | Bacteria | 595 |
| 72 | Ga0466705_516440 | 3300042612 | Bacteria | 7492 |
| 73 | Ga0466711_065445 | 3300042615 | Bacteria | 10264 |
| 74 | Ga0466715_298973 | 3300042616 | Bacteria | 10837 |
| 75 | Ga0466734_056677 | 3300042623 | Bacteria | 1588 |
| 76 | Ga0466735_002522 | 3300042624 | Bacteria | 1686 |
| 77 | Ga0466735_167137 | 3300042624 | Bacteria | 4646 |
| 78 | Ga0466700_210353 | 3300042600 | Bacteria | 2238 |
| 79 | Ga0466713_064722 | 3300042602 | Bacteria | 78418 |
| 80 | Ga0466716_156497 | 3300042605 | Bacteria | 15316 |
| 81 | Ga0466716_302604 | 3300042605 | Bacteria | 1298 |
| 82 | IMNBL1DRAFT_c0003112 | 3300000062 | Bacteria | 10937 |
| 83 | JGI24702J35022_10032110 | 3300002462 | Bacteria | 2812 |
| 84 | JGI24705J35276_12092089 | 3300002504 | Bacteria | 997 |
| 85 | JGI24699J35502_11134132 | 3300002509 | Bacteria | 35055 |
| 86 | Ga0466733_029825 | 3300042659 | Unclassified | 1395 |
| 87 | Ga0466690_253390 | 3300042590 | Bacteria | 6646 |
| 88 | Ga0466691_106939 | 3300042593 | Bacteria | 15943 |
| 89 | Ga0466696_100243 | 3300042596 | Bacteria | 1503 |
| 90 | Ga0466696_119043 | 3300042596 | Bacteria | 6088 |
| 91 | Ga0466711_443784 | 3300042615 | Bacteria | 1508 |
| 92 | Ga0466715_103901 | 3300042616 | Bacteria | 35101 |
| 93 | Ga0466723_210560 | 3300042618 | Bacteria | 37552 |
| 94 | Ga0466728_295918 | 3300042620 | Bacteria | 1152 |
| 95 | Ga0466703_066760 | 3300042636 | Bacteria | 13510 |
| 96 | Ga0466703_083046 | 3300042636 | Bacteria | 4858 |
| 97 | Ga0466709_188897 | 3300042648 | Unclassified | 3631 |
| 98 | Ga0466706_078292 | 3300042599 | Bacteria | 3904 |
| 99 | Ga0466706_267628 | 3300042599 | Bacteria | 1555 |
| 100 | Ga0466719_538919 | 3300042606 | Bacteria | 9974 |
| 101 | Ga0466722_017922 | 3300042609 | Bacteria | 50732 |
| 102 | 2227383577 | 2225789004 | Bacteria | 5915 |
| 103 | 2227487422 | 2225789004 | Bacteria | 4203 |
| 104 | IMNBL1DRAFT_c0027460 | 3300000062 | Bacteria | 2140 |
| 105 | JGI24699J35502_11134222 | 3300002509 | Bacteria | 70815 |
| 106 | Ga0466705_282524 | 3300042612 | Bacteria | 11717 |
| 107 | Ga0123356_10068234 | 3300010049 | Bacteria | 3331 |
| 108 | Ga0466712_041052 | 3300042614 | Bacteria | 3048 |
| 109 | Ga0466711_128137 | 3300042615 | Bacteria | 13195 |
| 110 | Ga0466711_236376 | 3300042615 | Bacteria | 1126 |
| 111 | Ga0466715_303196 | 3300042616 | Bacteria | 15918 |
| 112 | Ga0466728_106770 | 3300042620 | Bacteria | 3615 |
| 113 | Ga0466729_285812 | 3300042621 | Bacteria | 3112 |
| 114 | Ga0466719_104295 | 3300042606 | Bacteria | 9326 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042599 | Ga0466706_078292 | Ga0466706_078292_2524_3003 | 159 |
| 2 | 3300042615 | Ga0466711_279510 | Ga0466711_279510_3435_3986 | 167 |
| 3 | 3300002462 | JGI24702J35022_10032110 | JGI24702J35022_100321103 | 172 |
| 4 | 3300042605 | Ga0466716_046789 | Ga0466716_046789_3777_4298 | 173 |
| 5 | 3300042615 | Ga0466711_376634 | Ga0466711_376634_13_534 | 173 |
| 6 | 3300042636 | Ga0466703_310367 | Ga0466703_310367_2456_2977 | 173 |
| 7 | 2225789004 | 2227383577 | 2227828605 | 174 |
| 8 | 2225789004 | 2227656587 | 2228255007 | 174 |
| 9 | 3300002509 | JGI24699J35502_11134132 | JGI24699J35502_111341321 | 174 |
| 10 | 3300042582 | Ga0466657_082786 | Ga0466657_082786_940_1464 | 174 |
| 11 | 3300042590 | Ga0466690_167263 | Ga0466690_167263_24746_25270 | 174 |
| 12 | 3300042590 | Ga0466690_185181 | Ga0466690_185181_7292_7816 | 174 |
| 13 | 3300042590 | Ga0466690_190126 | Ga0466690_190126_3590_4114 | 174 |
| 14 | 3300042590 | Ga0466690_254172 | Ga0466690_254172_50317_50841 | 174 |
| 15 | 3300042590 | Ga0466690_421533 | Ga0466690_421533_149_673 | 174 |
| 16 | 3300042591 | Ga0466692_014618 | Ga0466692_014618_26847_27371 | 174 |
| 17 | 3300042591 | Ga0466692_029223 | Ga0466692_029223_4608_5132 | 174 |
| 18 | 3300042591 | Ga0466692_092628 | Ga0466692_092628_635_1159 | 174 |
| 19 | 3300042591 | Ga0466692_204059 | Ga0466692_204059_1011_1535 | 174 |
| 20 | 3300042593 | Ga0466691_106939 | Ga0466691_106939_1148_1672 | 174 |
| 21 | 3300042593 | Ga0466691_159995 | Ga0466691_159995_8315_8839 | 174 |
| 22 | 3300042594 | Ga0466694_028735 | Ga0466694_028735_30_554 | 174 |
| 23 | 3300042594 | Ga0466694_041598 | Ga0466694_041598_63_587 | 174 |
| 24 | 3300042594 | Ga0466694_057971 | Ga0466694_057971_324_848 | 174 |
| 25 | 3300042594 | Ga0466694_274940 | Ga0466694_274940_341_865 | 174 |
| 26 | 3300042596 | Ga0466696_429349 | Ga0466696_429349_72_596 | 174 |
| 27 | 3300042600 | Ga0466700_210353 | Ga0466700_210353_759_1283 | 174 |
| 28 | 3300042606 | Ga0466719_104295 | Ga0466719_104295_87_611 | 174 |
| 29 | 3300042609 | Ga0466722_109117 | Ga0466722_109117_8744_9268 | 174 |
| 30 | 3300042610 | Ga0466698_426981 | Ga0466698_426981_745_1269 | 174 |
| 31 | 3300042612 | Ga0466705_282524 | Ga0466705_282524_2800_3324 | 174 |
| 32 | 3300042613 | Ga0466710_041540 | Ga0466710_041540_322_846 | 174 |
| 33 | 3300042613 | Ga0466710_285493 | Ga0466710_285493_148_672 | 174 |
| 34 | 3300042614 | Ga0466712_041052 | Ga0466712_041052_1127_1651 | 174 |
| 35 | 3300042615 | Ga0466711_236376 | Ga0466711_236376_579_1103 | 174 |
| 36 | 3300042615 | Ga0466711_443784 | Ga0466711_443784_191_715 | 174 |
| 37 | 3300042616 | Ga0466715_007427 | Ga0466715_007427_19_543 | 174 |
| 38 | 3300042616 | Ga0466715_079574 | Ga0466715_079574_15232_15756 | 174 |
| 39 | 3300042616 | Ga0466715_103901 | Ga0466715_103901_17940_18464 | 174 |
| 40 | 3300042616 | Ga0466715_274089 | Ga0466715_274089_3260_3784 | 174 |
| 41 | 3300042616 | Ga0466715_303196 | Ga0466715_303196_13564_14088 | 174 |
| 42 | 3300042616 | Ga0466715_410357 | Ga0466715_410357_2469_2993 | 174 |
| 43 | 3300042618 | Ga0466723_030817 | Ga0466723_030817_1282_1806 | 174 |
| 44 | 3300042618 | Ga0466723_293295 | Ga0466723_293295_1576_2100 | 174 |
| 45 | 3300042619 | Ga0466726_057364 | Ga0466726_057364_1847_2371 | 174 |
| 46 | 3300042620 | Ga0466728_106770 | Ga0466728_106770_1280_1804 | 174 |
| 47 | 3300042621 | Ga0466729_285812 | Ga0466729_285812_1022_1546 | 174 |
| 48 | 3300042623 | Ga0466734_056677 | Ga0466734_056677_764_1288 | 174 |
| 49 | 3300042624 | Ga0466735_002522 | Ga0466735_002522_1039_1563 | 174 |
| 50 | 3300042624 | Ga0466735_167137 | Ga0466735_167137_3340_3864 | 174 |
| 51 | 3300042635 | Ga0466702_058496 | Ga0466702_058496_501_1025 | 174 |
| 52 | 3300042636 | Ga0466703_083046 | Ga0466703_083046_2617_3141 | 174 |
| 53 | 3300042648 | Ga0466709_204440 | Ga0466709_204440_29116_29640 | 174 |
| 54 | 3300042655 | Ga0466727_179323 | Ga0466727_179323_1341_1865 | 174 |
| 55 | 3300042659 | Ga0466733_029825 | Ga0466733_029825_370_894 | 174 |
| 56 | 3300042659 | Ga0466733_060357 | Ga0466733_060357_569_1093 | 174 |
| 57 | 3300042659 | Ga0466733_126817 | Ga0466733_126817_504_1028 | 174 |
| 58 | iso_pr_bacteria | 2820759988 | 2820762492 | 174 |
| 59 | iso_pr_bacteria | 2820762746 | 2820764437 | 174 |
| 60 | 3300000062 | IMNBL1DRAFT_c0003112 | IMNBL1DRAFT_00031128 | 175 |
| 61 | 3300000062 | IMNBL1DRAFT_c0027460 | IMNBL1DRAFT_00274603 | 175 |
| 62 | 3300002462 | JGI24702J35022_10318550 | JGI24702J35022_103185502 | 175 |
| 63 | 3300002504 | JGI24705J35276_12092089 | JGI24705J35276_120920892 | 175 |
| 64 | 3300002509 | JGI24699J35502_11134168 | JGI24699J35502_1113416812 | 175 |
| 65 | 3300002509 | JGI24699J35502_11134222 | JGI24699J35502_1113422256 | 175 |
| 66 | 3300002834 | JGI24696J40584_12943910 | JGI24696J40584_129439102 | 175 |
| 67 | 3300005201 | Ga0072941_1406816 | Ga0072941_14068161 | 175 |
| 68 | 3300009784 | Ga0123357_10023869 | Ga0123357_100238695 | 175 |
| 69 | 3300009784 | Ga0123357_10306385 | Ga0123357_103063852 | 175 |
| 70 | 3300009784 | Ga0123357_10343707 | Ga0123357_103437071 | 175 |
| 71 | 3300010049 | Ga0123356_10009226 | Ga0123356_100092268 | 175 |
| 72 | 3300010049 | Ga0123356_10292724 | Ga0123356_102927243 | 175 |
| 73 | 3300010049 | Ga0123356_12944746 | Ga0123356_129447461 | 175 |
| 74 | 3300010167 | Ga0123353_10060571 | Ga0123353_100605713 | 175 |
| 75 | 3300010167 | Ga0123353_10183823 | Ga0123353_101838233 | 175 |
| 76 | 3300010167 | Ga0123353_10201973 | Ga0123353_102019734 | 175 |
| 77 | 3300010167 | Ga0123353_11082934 | Ga0123353_110829342 | 175 |
| 78 | 3300010882 | Ga0123354_10280084 | Ga0123354_102800843 | 175 |
| 79 | iso_pr_bacteria | 2940216256 | 2940217050 | 175 |
| 80 | 3300042615 | Ga0466711_296497 | Ga0466711_296497_6950_7483 | 177 |
| 81 | 3300042591 | Ga0466692_016465 | Ga0466692_016465_49097_49645 | 182 |
| 82 | 3300042591 | Ga0466692_084947 | Ga0466692_084947_41417_41965 | 182 |
| 83 | 3300042596 | Ga0466696_213422 | Ga0466696_213422_10254_10802 | 182 |
| 84 | 3300042599 | Ga0466706_267628 | Ga0466706_267628_747_1295 | 182 |
| 85 | 3300042609 | Ga0466722_017922 | Ga0466722_017922_37210_37758 | 182 |
| 86 | 3300042609 | Ga0466722_097084 | Ga0466722_097084_8975_9523 | 182 |
| 87 | 3300042609 | Ga0466722_200813 | Ga0466722_200813_3853_4401 | 182 |
| 88 | 3300042636 | Ga0466703_002887 | Ga0466703_002887_5161_5709 | 182 |
| 89 | 3300042636 | Ga0466703_066760 | Ga0466703_066760_358_906 | 182 |
| 90 | iso_pr_bacteria | 2923982719 | 2923983015 | 182 |
| 91 | iso_pr_bacteria | 2940371297 | 2940372785 | 182 |
| 92 | 2225789003 | 2227047047 | 2227405924 | 183 |
| 93 | 2225789004 | 2227487422 | 2227955232 | 183 |
| 94 | 3300042605 | Ga0466716_156497 | Ga0466716_156497_4015_4566 | 183 |
| 95 | 3300042612 | Ga0466705_191830 | Ga0466705_191830_9544_10095 | 183 |
| 96 | 3300042612 | Ga0466705_516440 | Ga0466705_516440_1217_1768 | 183 |
| 97 | 3300042615 | Ga0466711_065445 | Ga0466711_065445_8551_9102 | 183 |
| 98 | 3300042615 | Ga0466711_117473 | Ga0466711_117473_10473_11024 | 183 |
| 99 | 3300042615 | Ga0466711_128137 | Ga0466711_128137_4411_4962 | 183 |
| 100 | 3300042616 | Ga0466715_298973 | Ga0466715_298973_10064_10615 | 183 |
| 101 | 3300042618 | Ga0466723_210560 | Ga0466723_210560_27085_27636 | 183 |
| 102 | 3300042620 | Ga0466728_295918 | Ga0466728_295918_343_894 | 183 |
| 103 | 3300042624 | Ga0466735_088271 | Ga0466735_088271_344_895 | 183 |
| 104 | 3300042624 | Ga0466735_191831 | Ga0466735_191831_501_1052 | 183 |
| 105 | 3300042643 | Ga0466704_587040 | Ga0466704_587040_16250_16801 | 183 |
| 106 | 3300042648 | Ga0466709_188897 | Ga0466709_188897_2743_3294 | 183 |
| 107 | 3300042652 | Ga0466708_204109 | Ga0466708_204109_3125_3676 | 183 |
| 108 | iso_pr_bacteria | 2940202316 | 2940202548 | 183 |
| 109 | 3300000062 | IMNBL1DRAFT_c0002114 | IMNBL1DRAFT_00021146 | 184 |
| 110 | 3300042590 | Ga0466690_286689 | Ga0466690_286689_2138_2692 | 184 |
| 111 | 3300042596 | Ga0466696_100243 | Ga0466696_100243_98_652 | 184 |
| 112 | 3300042605 | Ga0466716_302604 | Ga0466716_302604_350_904 | 184 |
| 113 | 3300042606 | Ga0466719_538919 | Ga0466719_538919_4506_5060 | 184 |
| 114 | 3300042590 | Ga0466690_253390 | Ga0466690_253390_535_1092 | 185 |
| 115 | 3300042615 | Ga0466711_154202 | Ga0466711_154202_534_1091 | 185 |
| 116 | 3300042616 | Ga0466715_037009 | Ga0466715_037009_83955_84512 | 185 |
| 117 | 3300042602 | Ga0466713_064722 | Ga0466713_064722_31717_32280 | 187 |
| 118 | iso_pr_bacteria | 2820582954 | 2820584147 | 190 |
| 119 | 3300010049 | Ga0123356_10068234 | Ga0123356_100682343 | 191 |
| 120 | 3300042596 | Ga0466696_119043 | Ga0466696_119043_1924_2514 | 196 |
| 121 | 3300042609 | Ga0466722_132071 | Ga0466722_132071_12756_13358 | 200 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02417 | Chromate_transp | Chromate transporter | 4 | 163 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.41 | 0.51 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.