Protein Family IF07530

Metagenome Isolate
165 Members
48 Samples
162 Scaffolds
114.59 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_229235|Ga0466711_229235_591_995
Length
134 aa
Sequence
MRLLWGGVNKTGALWYKGNIMDDCIFCKIIAGEIPGRKIYEDDEMLAFHDINPQSPVHFLLIPKRHIPNIMELGPGDIALAGRLLYKAQELAGLLGCAEKGARFVINHKSDGGQTVDHLHIHVLGGRPLAWPPG

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.8%
Kalotermitidae 29.2%
Rhinotermitidae 8.3%
Termopsidae 6.2%
Unclassified 4.2%
Culicidae 4.2%
Alydidae 2.1%
Blaberidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
37 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 2772190975 Treponema sp. RmG30 Isolate Blaberidae
41 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_133772 3300042656 Bacteria 3810
2 Ga0123356_10303723 3300010049 Bacteria 1702
3 Ga0466690_225277 3300042590 Unclassified 5474
4 Ga0466692_077793 3300042591 Bacteria 13288
5 Ga0466691_199989 3300042593 Bacteria 1082
6 Ga0466719_016908 3300042606 Bacteria 25606
7 Ga0466720_025302 3300042607 Bacteria 9128
8 Ga0466720_063778 3300042607 Bacteria 2132
9 Ga0466711_184950 3300042615 Bacteria 5823
10 Ga0466718_010831 3300042617 Bacteria 16954
11 Ga0466723_011867 3300042618 Bacteria 5048
12 Ga0466723_223711 3300042618 Bacteria 3349
13 Ga0466723_271934 3300042618 Bacteria 6848
14 JGI24695J34938_10126134 3300002450 Bacteria 1043
15 JGI24702J35022_10008378 3300002462 Bacteria 5854
16 Ga0466732_010791 3300042656 Bacteria 9084
17 Ga0466691_010871 3300042593 Bacteria 49888
18 Ga0466696_304119 3300042596 Bacteria 2421
19 Ga0466707_411102 3300042601 Bacteria 1092
20 Ga0466722_091914 3300042609 Bacteria 5920
21 Ga0466715_327706 3300042616 Bacteria 2302
22 Ga0466723_371918 3300042618 Bacteria 1873
23 Ga0466726_060014 3300042619 Bacteria 12594
24 Ga0466704_559417 3300042643 Bacteria 7617
25 Ga0466727_183282 3300042655 Bacteria 9933
26 Ga0466732_261181 3300042656 Bacteria 7125
27 Ga0466732_302267 3300042656 Bacteria 17743
28 Ga0123357_10167713 3300009784 Bacteria 2609
29 Ga0123356_11247005 3300010049 Bacteria 908
30 Ga0123356_11253991 3300010049 Unclassified 906
31 Ga0123356_12478249 3300010049 Bacteria 649
32 Ga0123353_10966949 3300010167 Bacteria 1149
33 Ga0123353_11084354 3300010167 Bacteria 1065
34 Ga0415639_000496 3300038395 Bacteria 2450
35 Ga0466691_019433 3300042593 Bacteria 4955
36 Ga0466699_036517 3300042597 Bacteria 13115
37 Ga0466707_020783 3300042601 Bacteria 1011
38 Ga0466719_033453 3300042606 Bacteria 2219
39 Ga0466712_232259 3300042614 Bacteria 1170
40 Ga0466711_128285 3300042615 Bacteria 23830
41 Ga0466718_156646 3300042617 Bacteria 4956
42 Ga0466728_174451 3300042620 Bacteria 1479
43 Ga0466728_370423 3300042620 Bacteria 1004
44 JGI24695J34938_10024501 3300002450 Bacteria 2898
45 JGI24702J35022_10000436 3300002462 Bacteria 25172
46 Ga0466705_096146 3300042612 Bacteria 2081
47 Ga0123354_10330960 3300010882 Bacteria 1389
48 Ga0160470_102127 3300012813 Bacteria 3993
49 Ga0415639_011189 3300038395 Bacteria 3318
50 Ga0466696_035144 3300042596 Bacteria 3845
51 Ga0466696_210466 3300042596 Bacteria 1681
52 Ga0466696_351178 3300042596 Bacteria 3462
53 Ga0466716_381964 3300042605 Unclassified 1580
54 Ga0466719_216479 3300042606 Bacteria 2457
55 Ga0466720_137187 3300042607 Bacteria 15044
56 Ga0466722_158620 3300042609 Bacteria 9322
57 Ga0466722_159680 3300042609 Unclassified 1335
58 Ga0466712_073120 3300042614 Bacteria 11288
59 Ga0466712_267126 3300042614 Bacteria 1646
60 Ga0466711_166179 3300042615 Bacteria 4283
61 Ga0466711_181274 3300042615 Bacteria 1530
62 Ga0466711_229235 3300042615 Bacteria 1034
63 Ga0466723_299213 3300042618 Bacteria 2679
64 Ga0466726_462529 3300042619 Bacteria 1890
65 Ga0466729_102216 3300042621 Bacteria 1784
66 AustNasuHG_c1010487 3300000089 Bacteria 3227
67 JGI24698J34947_10123358 3300002449 Bacteria 1120
68 Ga0466705_195947 3300042612 Bacteria 5179
69 Ga0466704_247319 3300042643 Bacteria 1991
70 Ga0466727_137357 3300042655 Bacteria 1851
71 Ga0160459_100087 3300012831 Unclassified 102976
72 Ga0466691_051130 3300042593 Bacteria 2016
73 Ga0466716_086078 3300042605 Bacteria 3485
74 Ga0466720_065988 3300042607 Unclassified 10464
75 Ga0466720_075768 3300042607 Bacteria 11472
76 Ga0466720_223011 3300042607 Bacteria 10637
77 Ga0466722_142767 3300042609 Bacteria 1939
78 Ga0466711_370467 3300042615 Bacteria 26278
79 Ga0466723_134094 3300042618 Bacteria 5226
80 Ga0466723_209645 3300042618 Unclassified 2840
81 Ga0466726_134888 3300042619 Bacteria 16994
82 JGI24698J34947_10004547 3300002449 Bacteria 7557
83 JGI24695J34938_10476724 3300002450 Bacteria 567
84 Ga0466705_081578 3300042612 Bacteria 4570
85 Ga0466727_301489 3300042655 Bacteria 4275
86 Ga0466690_290489 3300042590 Bacteria 16449
87 Ga0466696_214698 3300042596 Bacteria 1572
88 Ga0466699_393490 3300042597 Bacteria 1767
89 Ga0466699_441566 3300042597 Bacteria 11968
90 Ga0466707_244499 3300042601 Bacteria 2609
91 Ga0466717_074479 3300042604 Bacteria 1877
92 Ga0466719_012937 3300042606 Bacteria 1714
93 Ga0466712_089271 3300042614 Bacteria 10329
94 Ga0466718_035952 3300042617 Bacteria 12566
95 JGI24695J34938_10001739 3300002450 Bacteria 18011
96 Ga0466705_058541 3300042612 Bacteria 23211
97 Ga0466703_035126 3300042636 Unclassified 7838
98 Ga0466709_019236 3300042648 Bacteria 18315
99 Ga0466709_069183 3300042648 Bacteria 9816
100 Ga0123356_10462299 3300010049 Bacteria 1419
101 Ga0456237_0002968 3300041968 Bacteria 2756
102 Ga0466690_089720 3300042590 Bacteria 2143
103 Ga0466692_018240 3300042591 Bacteria 1005
104 Ga0466692_148938 3300042591 Bacteria 8077
105 Ga0466699_008552 3300042597 Unclassified 2707
106 Ga0466707_423295 3300042601 Unclassified 1460
107 Ga0466716_049451 3300042605 Bacteria 1177
108 Ga0466720_066322 3300042607 Bacteria 8494
109 Ga0466722_005318 3300042609 Bacteria 2038
110 Ga0466722_148488 3300042609 Bacteria 1665
111 Ga0466722_157426 3300042609 Bacteria 2224
112 Ga0466722_242343 3300042609 Bacteria 7097
113 Ga0466698_416215 3300042610 Bacteria 1713
114 Ga0466705_499092 3300042612 Bacteria 2935
115 Ga0466726_031363 3300042619 Bacteria 20660
116 Ga0466728_198803 3300042620 Bacteria 6460
117 JGI24698J34947_10218795 3300002449 Bacteria 732
118 JGI24695J34938_10055086 3300002450 Bacteria 1721
119 JGI24705J35276_11404010 3300002504 Bacteria 528
120 JGI24699J35502_10488093 3300002509 Bacteria 609
121 Ga0072940_1026603 3300005200 Bacteria 1455
122 Ga0466705_075588 3300042612 Bacteria 9194
123 Ga0466705_258660 3300042612 Bacteria 3079
124 Ga0466735_101671 3300042624 Bacteria 2406
125 Ga0466708_293306 3300042652 Unclassified 2479
126 Ga0466727_192609 3300042655 Bacteria 10130
127 Ga0123357_10043634 3300009784 Bacteria 6092
128 Ga0123356_10095923 3300010049 Bacteria 2835
129 Ga0123356_11093522 3300010049 Bacteria 966
130 Ga0456237_0000162 3300041968 Bacteria 9687
131 Ga0466696_029803 3300042596 Bacteria 25127
132 Ga0466707_050376 3300042601 Bacteria 3167
133 Ga0466707_234091 3300042601 Bacteria 1215
134 Ga0466707_263773 3300042601 Bacteria 1045
135 Ga0466716_132104 3300042605 Bacteria 3767
136 Ga0466719_073441 3300042606 Bacteria 6541
137 Ga0466722_076800 3300042609 Unclassified 2633
138 Ga0466712_046764 3300042614 Bacteria 3647
139 Ga0466715_004875 3300042616 Bacteria 8067
140 Ga0466715_045416 3300042616 Bacteria 3160
141 Ga0466715_492592 3300042616 Bacteria 12189
142 Ga0466718_131456 3300042617 Bacteria 1636
143 Ga0466728_181936 3300042620 Bacteria 2158
144 Nasutiter_Contig08649 2030936001 Unclassified 771
145 AustNasuHG_c1000386 3300000089 Bacteria 15293
146 AustNasuHG_c1023973 3300000089 Bacteria 1941
147 AustNasuHG_c1082068 3300000089 Bacteria 542
148 JGI24698J34947_10001256 3300002449 Bacteria 13265
149 JGI24698J34947_10036207 3300002449 Bacteria 2571
150 JGI24698J34947_10037204 3300002449 Bacteria 2530
151 JGI24698J34947_10063426 3300002449 Unclassified 1811
152 JGI24698J34947_10077358 3300002449 Unclassified 1573
153 JGI24695J34938_10010183 3300002450 Bacteria 5175
154 Ga0074263_116734 3300005485 Bacteria 3245
155 Ga0466705_225699 3300042612 Unclassified 10304
156 Ga0466705_284233 3300042612 Bacteria 4116
157 Ga0466729_292794 3300042621 Bacteria 2360
158 Ga0466704_506118 3300042643 Bacteria 2825
159 Ga0466709_029540 3300042648 Bacteria 12536
160 Ga0466709_415969 3300042648 Bacteria 1021
161 Ga0466708_058741 3300042652 Unclassified 2155
162 Ga0466727_260572 3300042655 Unclassified 3050

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_181274 Ga0466711_181274_459_794 111
2 3300042596 Ga0466696_029803 Ga0466696_029803_7672_8010 112
3 3300042618 Ga0466723_223711 Ga0466723_223711_1995_2333 112
4 3300042610 Ga0466698_416215 Ga0466698_416215_105_446 113
5 3300042612 Ga0466705_225699 Ga0466705_225699_7101_7442 113
6 3300042614 Ga0466712_267126 Ga0466712_267126_1246_1587 113
7 2030936001 Nasutiter_Contig08649 Nasutiterm_1249190 114
8 3300002449 JGI24698J34947_10004547 JGI24698J34947_100045473 114
9 3300002449 JGI24698J34947_10063426 JGI24698J34947_100634263 114
10 3300002450 JGI24695J34938_10024501 JGI24695J34938_100245011 114
11 3300038395 Ga0415639_000496 Ga0415639_000496_1993_2337 114
12 3300038395 Ga0415639_011189 Ga0415639_011189_1081_1425 114
13 3300041968 Ga0456237_0000162 Ga0456237_0000162_4224_4568 114
14 3300041968 Ga0456237_0002968 Ga0456237_0002968_288_632 114
15 3300042590 Ga0466690_089720 Ga0466690_089720_716_1060 114
16 3300042590 Ga0466690_225277 Ga0466690_225277_4165_4509 114
17 3300042590 Ga0466690_290489 Ga0466690_290489_15212_15556 114
18 3300042591 Ga0466692_018240 Ga0466692_018240_91_435 114
19 3300042591 Ga0466692_077793 Ga0466692_077793_1362_1706 114
20 3300042591 Ga0466692_148938 Ga0466692_148938_5379_5723 114
21 3300042593 Ga0466691_010871 Ga0466691_010871_37146_37490 114
22 3300042593 Ga0466691_019433 Ga0466691_019433_4121_4465 114
23 3300042593 Ga0466691_051130 Ga0466691_051130_1308_1652 114
24 3300042596 Ga0466696_035144 Ga0466696_035144_3403_3747 114
25 3300042596 Ga0466696_210466 Ga0466696_210466_70_414 114
26 3300042596 Ga0466696_214698 Ga0466696_214698_580_924 114
27 3300042596 Ga0466696_304119 Ga0466696_304119_27_371 114
28 3300042596 Ga0466696_351178 Ga0466696_351178_2620_2964 114
29 3300042601 Ga0466707_020783 Ga0466707_020783_153_497 114
30 3300042601 Ga0466707_050376 Ga0466707_050376_1809_2153 114
31 3300042601 Ga0466707_234091 Ga0466707_234091_640_984 114
32 3300042601 Ga0466707_244499 Ga0466707_244499_221_565 114
33 3300042601 Ga0466707_263773 Ga0466707_263773_497_841 114
34 3300042601 Ga0466707_411102 Ga0466707_411102_60_404 114
35 3300042601 Ga0466707_423295 Ga0466707_423295_856_1200 114
36 3300042604 Ga0466717_074479 Ga0466717_074479_450_794 114
37 3300042605 Ga0466716_049451 Ga0466716_049451_575_919 114
38 3300042605 Ga0466716_086078 Ga0466716_086078_669_1013 114
39 3300042605 Ga0466716_132104 Ga0466716_132104_2720_3064 114
40 3300042605 Ga0466716_381964 Ga0466716_381964_240_584 114
41 3300042606 Ga0466719_012937 Ga0466719_012937_547_891 114
42 3300042606 Ga0466719_016908 Ga0466719_016908_16833_17177 114
43 3300042606 Ga0466719_033453 Ga0466719_033453_1655_1999 114
44 3300042606 Ga0466719_073441 Ga0466719_073441_4517_4861 114
45 3300042606 Ga0466719_216479 Ga0466719_216479_1454_1798 114
46 3300042607 Ga0466720_025302 Ga0466720_025302_6133_6477 114
47 3300042607 Ga0466720_063778 Ga0466720_063778_1682_2026 114
48 3300042607 Ga0466720_065988 Ga0466720_065988_2924_3268 114
49 3300042607 Ga0466720_066322 Ga0466720_066322_3748_4092 114
50 3300042607 Ga0466720_075768 Ga0466720_075768_3697_4041 114
51 3300042607 Ga0466720_137187 Ga0466720_137187_5672_6016 114
52 3300042607 Ga0466720_223011 Ga0466720_223011_5921_6265 114
53 3300042609 Ga0466722_005318 Ga0466722_005318_550_894 114
54 3300042609 Ga0466722_076800 Ga0466722_076800_1778_2122 114
55 3300042609 Ga0466722_091914 Ga0466722_091914_4677_5021 114
56 3300042609 Ga0466722_142767 Ga0466722_142767_577_921 114
57 3300042609 Ga0466722_148488 Ga0466722_148488_1081_1425 114
58 3300042609 Ga0466722_157426 Ga0466722_157426_1044_1388 114
59 3300042609 Ga0466722_158620 Ga0466722_158620_167_511 114
60 3300042609 Ga0466722_159680 Ga0466722_159680_505_849 114
61 3300042609 Ga0466722_242343 Ga0466722_242343_2589_2933 114
62 3300042612 Ga0466705_058541 Ga0466705_058541_7993_8337 114
63 3300042612 Ga0466705_075588 Ga0466705_075588_5816_6160 114
64 3300042612 Ga0466705_081578 Ga0466705_081578_2058_2402 114
65 3300042612 Ga0466705_096146 Ga0466705_096146_1443_1787 114
66 3300042612 Ga0466705_258660 Ga0466705_258660_401_745 114
67 3300042612 Ga0466705_284233 Ga0466705_284233_946_1290 114
68 3300042614 Ga0466712_046764 Ga0466712_046764_1178_1522 114
69 3300042614 Ga0466712_073120 Ga0466712_073120_54_398 114
70 3300042614 Ga0466712_089271 Ga0466712_089271_7463_7807 114
71 3300042614 Ga0466712_232259 Ga0466712_232259_459_803 114
72 3300042615 Ga0466711_128285 Ga0466711_128285_17919_18263 114
73 3300042615 Ga0466711_166179 Ga0466711_166179_1884_2228 114
74 3300042615 Ga0466711_184950 Ga0466711_184950_2366_2710 114
75 3300042615 Ga0466711_370467 Ga0466711_370467_14655_14999 114
76 3300042616 Ga0466715_004875 Ga0466715_004875_1426_1770 114
77 3300042616 Ga0466715_045416 Ga0466715_045416_672_1016 114
78 3300042616 Ga0466715_327706 Ga0466715_327706_1764_2108 114
79 3300042616 Ga0466715_492592 Ga0466715_492592_8335_8679 114
80 3300042617 Ga0466718_010831 Ga0466718_010831_9393_9737 114
81 3300042617 Ga0466718_035952 Ga0466718_035952_3724_4068 114
82 3300042617 Ga0466718_131456 Ga0466718_131456_1163_1507 114
83 3300042617 Ga0466718_156646 Ga0466718_156646_2234_2578 114
84 3300042618 Ga0466723_011867 Ga0466723_011867_1703_2047 114
85 3300042618 Ga0466723_134094 Ga0466723_134094_1353_1697 114
86 3300042618 Ga0466723_209645 Ga0466723_209645_820_1164 114
87 3300042618 Ga0466723_271934 Ga0466723_271934_5119_5463 114
88 3300042618 Ga0466723_299213 Ga0466723_299213_2214_2558 114
89 3300042618 Ga0466723_371918 Ga0466723_371918_590_934 114
90 3300042619 Ga0466726_031363 Ga0466726_031363_3264_3608 114
91 3300042619 Ga0466726_060014 Ga0466726_060014_9163_9507 114
92 3300042619 Ga0466726_134888 Ga0466726_134888_9791_10135 114
93 3300042619 Ga0466726_462529 Ga0466726_462529_746_1090 114
94 3300042620 Ga0466728_174451 Ga0466728_174451_351_695 114
95 3300042620 Ga0466728_181936 Ga0466728_181936_52_396 114
96 3300042620 Ga0466728_198803 Ga0466728_198803_382_726 114
97 3300042620 Ga0466728_370423 Ga0466728_370423_360_704 114
98 3300042621 Ga0466729_102216 Ga0466729_102216_790_1134 114
99 3300042621 Ga0466729_292794 Ga0466729_292794_1913_2257 114
100 3300042624 Ga0466735_101671 Ga0466735_101671_897_1241 114
101 3300042636 Ga0466703_035126 Ga0466703_035126_1007_1351 114
102 3300042643 Ga0466704_247319 Ga0466704_247319_996_1340 114
103 3300042643 Ga0466704_506118 Ga0466704_506118_1215_1559 114
104 3300042643 Ga0466704_559417 Ga0466704_559417_1017_1361 114
105 3300042648 Ga0466709_019236 Ga0466709_019236_14955_15299 114
106 3300042648 Ga0466709_029540 Ga0466709_029540_11287_11631 114
107 3300042648 Ga0466709_069183 Ga0466709_069183_5772_6116 114
108 3300042648 Ga0466709_415969 Ga0466709_415969_516_860 114
109 3300042652 Ga0466708_058741 Ga0466708_058741_921_1265 114
110 3300042652 Ga0466708_293306 Ga0466708_293306_216_560 114
111 3300042655 Ga0466727_137357 Ga0466727_137357_875_1219 114
112 3300042655 Ga0466727_183282 Ga0466727_183282_4218_4562 114
113 3300042655 Ga0466727_192609 Ga0466727_192609_3802_4146 114
114 3300042655 Ga0466727_260572 Ga0466727_260572_1954_2298 114
115 3300042655 Ga0466727_301489 Ga0466727_301489_2827_3171 114
116 3300042656 Ga0466732_010791 Ga0466732_010791_4558_4902 114
117 3300042656 Ga0466732_133772 Ga0466732_133772_2414_2758 114
118 3300042656 Ga0466732_302267 Ga0466732_302267_9107_9451 114
119 iso_pr_bacteria 2772190975 2773721736 114
120 iso_pr_bacteria 2781125693 2781434438 114
121 3300000089 AustNasuHG_c1000386 AustNasuHG_100038617 115
122 3300000089 AustNasuHG_c1010487 AustNasuHG_10104873 115
123 3300000089 AustNasuHG_c1023973 AustNasuHG_10239733 115
124 3300000089 AustNasuHG_c1082068 AustNasuHG_10820682 115
125 3300002449 JGI24698J34947_10001256 JGI24698J34947_100012569 115
126 3300002449 JGI24698J34947_10036207 JGI24698J34947_100362071 115
127 3300002449 JGI24698J34947_10037204 JGI24698J34947_100372042 115
128 3300002449 JGI24698J34947_10077358 JGI24698J34947_100773582 115
129 3300002449 JGI24698J34947_10123358 JGI24698J34947_101233582 115
130 3300002450 JGI24695J34938_10001739 JGI24695J34938_1000173912 115
131 3300002450 JGI24695J34938_10010183 JGI24695J34938_100101835 115
132 3300002450 JGI24695J34938_10055086 JGI24695J34938_100550863 115
133 3300002450 JGI24695J34938_10126134 JGI24695J34938_101261343 115
134 3300002450 JGI24695J34938_10476724 JGI24695J34938_104767242 115
135 3300002462 JGI24702J35022_10000436 JGI24702J35022_1000043618 115
136 3300002504 JGI24705J35276_11404010 JGI24705J35276_114040101 115
137 3300002509 JGI24699J35502_10488093 JGI24699J35502_104880931 115
138 3300005200 Ga0072940_1026603 Ga0072940_10266033 115
139 3300005485 Ga0074263_116734 Ga0074263_1167343 115
140 3300009784 Ga0123357_10043634 Ga0123357_100436342 115
141 3300009784 Ga0123357_10167713 Ga0123357_101677134 115
142 3300010049 Ga0123356_10095923 Ga0123356_100959233 115
143 3300010049 Ga0123356_10303723 Ga0123356_103037232 115
144 3300010049 Ga0123356_10462299 Ga0123356_104622993 115
145 3300010049 Ga0123356_11093522 Ga0123356_110935223 115
146 3300010049 Ga0123356_11247005 Ga0123356_112470052 115
147 3300010049 Ga0123356_11253991 Ga0123356_112539912 115
148 3300010049 Ga0123356_12478249 Ga0123356_124782492 115
149 3300010167 Ga0123353_10966949 Ga0123353_109669492 115
150 3300010167 Ga0123353_11084354 Ga0123353_110843541 115
151 3300010882 Ga0123354_10330960 Ga0123354_103309602 115
152 3300042612 Ga0466705_499092 Ga0466705_499092_1063_1413 116
153 3300042593 Ga0466691_199989 Ga0466691_199989_680_1033 117
154 3300042597 Ga0466699_008552 Ga0466699_008552_1410_1763 117
155 3300042597 Ga0466699_036517 Ga0466699_036517_10585_10938 117
156 3300042597 Ga0466699_393490 Ga0466699_393490_436_789 117
157 3300042597 Ga0466699_441566 Ga0466699_441566_5253_5606 117
158 iso_pr_bacteria 8024031916 8024034785 118
159 3300012813 Ga0160470_102127 Ga0160470_1021275 119
160 3300012831 Ga0160459_100087 Ga0160459_10008782 119
161 3300042612 Ga0466705_195947 Ga0466705_195947_144_506 120
162 3300042656 Ga0466732_261181 Ga0466732_261181_395_757 120
163 3300002449 JGI24698J34947_10218795 JGI24698J34947_102187952 121
164 3300002462 JGI24702J35022_10008378 JGI24702J35022_100083781 121
165 3300042615 Ga0466711_229235 Ga0466711_229235_591_995 134

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01230 HIT HIT domain 32 128 0.96
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 24 125 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01230 GO:0003824 catalytic activity MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6ypr-assembly1.cif.gz_AAA-2 Human histidine triad nucleotide-binding protein 2 (hHINT2) refined to 1.26 A in H32 space group 0.985 40 134
6ypx-assembly1.cif.gz_AAA Human histidine triad nucleotide-binding protein 2 (hHINT2) refined to 2.11 A in C2221 space group 0.984 24 134
6d6j-assembly1.cif.gz_A Crystal structure of HIT family hydrolase from Legionella pneumophila Philadelphia 1 0.98 23 134
5waa-assembly1.cif.gz_B Human Histidine Triad Nucleotide Binding Protein 1 (hHint1) C84R mutant 0.978 23 134
6j65-assembly1.cif.gz_B Crystal structure of human HINT1 mutant complexing with AP4A II 0.976 23 134
IDDescriptionScoreStartEndSuperfamily
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9686 23 134 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9647 35 134 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9638 22 130 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9625 23 130 3.30.428.10
af_Q0DA95_1_91_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.954 46 134 3.30.428.10
IDDescriptionScoreStartEndGO Terms
AF-A0A7V3P726-F1-model_v4 Uncharacterized/unreviewed 0.9927 22 127
AF-A0A2M8NYR1-F1-model_v4 Uncharacterized/unreviewed 0.9923 23 130 GO:0003824
AF-A0A7V7AS81-F1-model_v4 Uncharacterized/unreviewed 0.9918 22 130

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.