Protein Family IF07520

Metagenome Isolate
141 Members
55 Samples
128 Scaffolds
455.42 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_204841|Ga0466711_204841_3119_4912
Length
526 aa
Sequence
VKAFSACVKNIFTGENLPALPFMPLLFSRIHGRIDFCKNKPVFCKKSIWQILFFPIILQCSKCLMYHRKKTVIMTTRRNFIKQSLSAGAGLFVAPTILPASVFGKHAPSNRINIGAIGTGRISRDHDMPGVWKYDDVRIVAVSDLDANRLAEGKQHVEAYYTKKTGAPYSGVATYPDYRDLLASKDVDAVLISTPDHWHAKNAIDAVRAGKHVYLQKPASLTIAEGRKMSDAVNACGKVFQIGSQQRSMEQFRVACELVRSGRLGQLKEIEIRLPGDPPGGNPEEMPVPAGFNYDMWLGQTPYVPYTVDRVHPQQGYGRPGWLRCEQFGAGMITGWGAHHFDIAHWAMDREYSGPVEIYGKSEFPTSGLWDVHGRYDTEMLYDNGVIVRGTTDSAEKPNGVMFTGTKGWLFVSRGNYAASPNEPISTKSNALQASDLKILSPLGDGDVRLYVSTDHHGNWLDSIRTGKMNITPAEVAHRSCTACLLQYIAMKLNRRLYWDPVQERFKNDDEANSMVARHHRPPYQF

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 25.9%
Termitidae 18.5%
Unclassified 14.8%
Blattidae 9.3%
Termopsidae 7.4%
Armadillidiidae 5.6%
Rhinotermitidae 3.7%
Formicidae 3.7%
Passalidae 3.7%
Elmidae 3.7%
Apidae 1.9%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
24 2923982719 Parabacteroides sp. 52 Isolate Blattidae
25 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
28 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
34 2864836148 Arcicella rosea S00070 Isolate Elmidae
35 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
38 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
44 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
45 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
49 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
50 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_007948 3300042612 Bacteria 28590
2 Ga0466705_261052 3300042612 Bacteria 6355
3 Ga0466733_103178 3300042659 Bacteria 47494
4 Ga0123353_10088816 3300010167 Bacteria 4977
5 Ga0123353_10109869 3300010167 Bacteria 4442
6 Ga0123353_10156544 3300010167 Bacteria 3631
7 Ga0466715_528153 3300042616 Bacteria 13469
8 Ga0466726_140233 3300042619 Unclassified 1956
9 Ga0466726_274172 3300042619 Bacteria 2059
10 Ga0466729_180156 3300042621 Bacteria 9265
11 Ga0466707_335945 3300042601 Bacteria 6321
12 Ga0466707_390721 3300042601 Bacteria 2165
13 Ga0466713_017528 3300042602 Bacteria 17038
14 Ga0466719_006715 3300042606 Bacteria 2430
15 Ga0466719_017423 3300042606 Bacteria 18388
16 Ga0466719_256813 3300042606 Bacteria 2038
17 Ga0466722_053810 3300042609 Bacteria 8083
18 Ga0160455_100004 3300012837 Bacteria 1044325
19 Ga0160443_100026 3300012848 Bacteria 373861
20 Ga0466691_105231 3300042593 Bacteria 29557
21 Ga0466696_010506 3300042596 Bacteria 22840
22 Ga0466696_474928 3300042596 Bacteria 6776
23 JGI24702J35022_10001876 3300002462 Bacteria 12932
24 JGI24702J35022_10014961 3300002462 Bacteria 4275
25 Ga0068305_10096087 3300005083 Bacteria 5337
26 Ga0466735_059196 3300042624 Bacteria 3106
27 Ga0466703_229463 3300042636 Bacteria 4102
28 Ga0466733_094600 3300042659 Bacteria 36697
29 Ga0123353_10109504 3300010167 Bacteria 4450
30 Ga0466705_437126 3300042612 Unclassified 10739
31 Ga0466711_051950 3300042615 Bacteria 5788
32 Ga0466711_305217 3300042615 Bacteria 4928
33 Ga0466715_098299 3300042616 Bacteria 65486
34 Ga0466713_040492 3300042602 Unclassified 7027
35 Ga0466690_047843 3300042590 Bacteria 7214
36 Ga0466690_330693 3300042590 Bacteria 3202
37 Ga0466690_378317 3300042590 Bacteria 4029
38 Ga0466691_046826 3300042593 Bacteria 4790
39 Ga0466696_430965 3300042596 Bacteria 5299
40 JGI24702J35022_10020298 3300002462 Bacteria 3608
41 Ga0466735_067741 3300042624 Bacteria 2307
42 Ga0466735_171695 3300042624 Bacteria 1854
43 Ga0466704_103112 3300042643 Bacteria 29222
44 Ga0466709_096708 3300042648 Bacteria 3160
45 Ga0466715_036672 3300042616 Bacteria 23788
46 Ga0466723_067547 3300042618 Bacteria 33416
47 Ga0466723_220968 3300042618 Bacteria 17855
48 Ga0466729_101293 3300042621 Bacteria 11011
49 Ga0466713_015314 3300042602 Bacteria 17205
50 Ga0466713_061441 3300042602 Bacteria 7603
51 Ga0466719_363604 3300042606 Bacteria 13734
52 Ga0466722_031688 3300042609 Bacteria 6351
53 Ga0466735_163464 3300042624 Bacteria 5255
54 Ga0466709_302521 3300042648 Bacteria 6086
55 Ga0466711_043993 3300042615 Bacteria 5021
56 Ga0466711_156027 3300042615 Bacteria 4239
57 Ga0466715_536570 3300042616 Bacteria 4758
58 Ga0466707_036147 3300042601 Bacteria 23567
59 Ga0466713_123288 3300042602 Bacteria 76789
60 Ga0466719_032559 3300042606 Bacteria 18343
61 Ga0466722_037867 3300042609 Bacteria 9497
62 Ga0466690_085121 3300042590 Bacteria 17010
63 Ga0466696_344308 3300042596 Bacteria 5354
64 Ga0466704_037116 3300042643 Bacteria 12810
65 Ga0466704_385503 3300042643 Bacteria 6348
66 Ga0466727_009125 3300042655 Bacteria 5613
67 Ga0466727_037732 3300042655 Bacteria 2435
68 Ga0466727_149072 3300042655 Bacteria 4232
69 Ga0466715_300559 3300042616 Bacteria 3962
70 Ga0466715_534302 3300042616 Bacteria 18335
71 Ga0466723_089568 3300042618 Bacteria 54083
72 Ga0466716_063630 3300042605 Bacteria 19460
73 Ga0466719_109892 3300042606 Bacteria 12415
74 Ga0466719_142516 3300042606 Bacteria 1678
75 Ga0466696_130476 3300042596 Bacteria 5156
76 Ga0068305_10183166 3300005083 Unclassified 4845
77 Ga0466734_108048 3300042623 Bacteria 2819
78 Ga0466735_055207 3300042624 Bacteria 8870
79 Ga0466725_138136 3300042654 Bacteria 17555
80 Ga0466733_120112 3300042659 Bacteria 197910
81 Ga0123355_10091523 3300009826 Bacteria 4821
82 Ga0123356_10000016 3300010049 Bacteria 186009
83 Ga0123353_10089054 3300010167 Bacteria 4970
84 Ga0466715_311238 3300042616 Bacteria 1992
85 Ga0466728_375768 3300042620 Bacteria 12214
86 Ga0466707_173945 3300042601 Bacteria 6129
87 Ga0466707_285115 3300042601 Bacteria 6373
88 Ga0160445_100114 3300012847 Bacteria 71378
89 Ga0160430_105692 3300012852 Archaea 2803
90 Ga0466657_259592 3300042582 Bacteria 3881
91 Ga0466690_280569 3300042590 Bacteria 14689
92 CVPL010W_10000743 3300002931 Bacteria 36440
93 Ga0068302_10110289 3300005071 Bacteria 7036
94 Ga0466735_147318 3300042624 Bacteria 8874
95 Ga0466703_223782 3300042636 Bacteria 8631
96 Ga0466709_005949 3300042648 Bacteria 4722
97 Ga0466708_104343 3300042652 Bacteria 12482
98 Ga0466727_299839 3300042655 Bacteria 21624
99 Ga0123357_10094813 3300009784 Bacteria 3872
100 Ga0123353_10062664 3300010167 Bacteria 5964
101 Ga0466711_334010 3300042615 Bacteria 1874
102 Ga0466706_170134 3300042599 Bacteria 4487
103 Ga0466716_496049 3300042605 Bacteria 8404
104 Ga0466691_116898 3300042593 Bacteria 11563
105 Ga0466696_011057 3300042596 Bacteria 5461
106 Ga0466696_203656 3300042596 Bacteria 11142
107 Ga0466696_207729 3300042596 Bacteria 4169
108 Ga0466696_497891 3300042596 Bacteria 1990
109 IMNBL1DRAFT_c0000691 3300000062 Bacteria 27022
110 Ga0102740_1000924 3300007140 Bacteria 7924
111 Ga0466703_082612 3300042636 Bacteria 35892
112 Ga0466703_167624 3300042636 Bacteria 8082
113 Ga0466704_329161 3300042643 Bacteria 13717
114 Ga0123353_10325258 3300010167 Bacteria 2331
115 Ga0466711_089760 3300042615 Bacteria 15063
116 Ga0466711_204841 3300042615 Bacteria 5340
117 Ga0466715_165908 3300042616 Unclassified 5239
118 Ga0466723_087765 3300042618 Bacteria 1925
119 Ga0466726_494862 3300042619 Bacteria 5576
120 Ga0466701_061881 3300042598 Bacteria 1739
121 Ga0466716_013915 3300042605 Bacteria 2671
122 Ga0466716_098196 3300042605 Bacteria 11814
123 2227499629 2225789004 Bacteria 19470
124 Ga0466735_049630 3300042624 Bacteria 15081
125 Ga0466735_154665 3300042624 Bacteria 1717
126 Ga0466735_200251 3300042624 Bacteria 1772
127 Ga0466704_121319 3300042643 Bacteria 43299
128 Ga0466708_467274 3300042652 Bacteria 20579

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_171695 Ga0466735_171695_386_1747 421
2 3300042624 Ga0466735_163464 Ga0466735_163464_28_1389 422
3 3300042636 Ga0466703_229463 Ga0466703_229463_311_1672 423
4 3300042606 Ga0466719_032559 Ga0466719_032559_619_1896 425
5 3300042606 Ga0466719_109892 Ga0466719_109892_7689_9050 425
6 3300042636 Ga0466703_223782 Ga0466703_223782_2141_3418 425
7 3300042643 Ga0466704_103112 Ga0466704_103112_2172_3449 425
8 3300042648 Ga0466709_302521 Ga0466709_302521_470_1750 426
9 3300009826 Ga0123355_10091523 Ga0123355_100915231 427
10 3300042615 Ga0466711_043993 Ga0466711_043993_885_2261 429
11 3300042601 Ga0466707_173945 Ga0466707_173945_2695_4056 435
12 3300042616 Ga0466715_536570 Ga0466715_536570_883_2193 436
13 iso_pr_bacteria 8065497608 8065500465 436
14 3300042602 Ga0466713_061441 Ga0466713_061441_2361_3746 438
15 3300042590 Ga0466690_047843 Ga0466690_047843_5813_7132 439
16 3300042643 Ga0466704_385503 Ga0466704_385503_4168_5487 439
17 3300042648 Ga0466709_096708 Ga0466709_096708_869_2188 439
18 3300042619 Ga0466726_274172 Ga0466726_274172_43_1371 442
19 3300010167 Ga0123353_10109869 Ga0123353_101098692 443
20 3300002931 CVPL010W_10000743 CVPL010W_1000074311 444
21 3300042624 Ga0466735_154665 Ga0466735_154665_195_1571 444
22 3300042609 Ga0466722_037867 Ga0466722_037867_4220_5581 445
23 3300042590 Ga0466690_085121 Ga0466690_085121_6070_7434 446
24 3300042596 Ga0466696_474928 Ga0466696_474928_595_1959 446
25 3300042618 Ga0466723_067547 Ga0466723_067547_16800_18164 446
26 3300009784 Ga0123357_10094813 Ga0123357_100948132 447
27 iso_pr_bacteria 2828301124 2828302986 447
28 iso_pr_bacteria 2864955722 2864957397 447
29 3300042590 Ga0466690_378317 Ga0466690_378317_922_2292 448
30 3300042596 Ga0466696_130476 Ga0466696_130476_138_1502 448
31 3300042599 Ga0466706_170134 Ga0466706_170134_1955_3301 448
32 3300042612 Ga0466705_437126 Ga0466705_437126_8912_10276 448
33 3300042596 Ga0466696_344308 Ga0466696_344308_3532_4902 450
34 3300042596 Ga0466696_497891 Ga0466696_497891_172_1524 450
35 iso_pr_bacteria 2820951912 2820954215 450
36 3300042624 Ga0466735_200251 Ga0466735_200251_180_1553 451
37 3300042590 Ga0466690_330693 Ga0466690_330693_735_2096 453
38 3300042593 Ga0466691_105231 Ga0466691_105231_10826_12187 453
39 3300042593 Ga0466691_116898 Ga0466691_116898_225_1586 453
40 3300042601 Ga0466707_036147 Ga0466707_036147_12661_14022 453
41 3300042601 Ga0466707_335945 Ga0466707_335945_1123_2484 453
42 3300042606 Ga0466719_256813 Ga0466719_256813_412_1773 453
43 3300042616 Ga0466715_534302 Ga0466715_534302_14639_16000 453
44 3300042619 Ga0466726_140233 Ga0466726_140233_379_1740 453
45 3300042619 Ga0466726_494862 Ga0466726_494862_3741_5102 453
46 3300042624 Ga0466735_049630 Ga0466735_049630_5531_6892 453
47 3300042624 Ga0466735_059196 Ga0466735_059196_85_1446 453
48 3300042643 Ga0466704_037116 Ga0466704_037116_8510_9871 453
49 3300042659 Ga0466733_120112 Ga0466733_120112_57648_59009 453
50 iso_pr_bacteria 2967483437 2967484282 453
51 3300042590 Ga0466690_280569 Ga0466690_280569_12000_13364 454
52 3300042601 Ga0466707_285115 Ga0466707_285115_4014_5378 454
53 3300042605 Ga0466716_063630 Ga0466716_063630_7900_9264 454
54 3300042605 Ga0466716_496049 Ga0466716_496049_5806_7170 454
55 3300042606 Ga0466719_363604 Ga0466719_363604_435_1799 454
56 3300042609 Ga0466722_031688 Ga0466722_031688_1211_2575 454
57 3300042609 Ga0466722_053810 Ga0466722_053810_2224_3588 454
58 3300042615 Ga0466711_156027 Ga0466711_156027_457_1821 454
59 3300042615 Ga0466711_334010 Ga0466711_334010_301_1665 454
60 3300042616 Ga0466715_098299 Ga0466715_098299_4126_5490 454
61 3300042618 Ga0466723_089568 Ga0466723_089568_26790_28154 454
62 3300042618 Ga0466723_220968 Ga0466723_220968_16211_17575 454
63 3300042624 Ga0466735_067741 Ga0466735_067741_319_1683 454
64 3300042643 Ga0466704_121319 Ga0466704_121319_32735_34099 454
65 3300042648 Ga0466709_005949 Ga0466709_005949_659_2023 454
66 3300042655 Ga0466727_009125 Ga0466727_009125_376_1740 454
67 3300042596 Ga0466696_010506 Ga0466696_010506_12929_14296 455
68 3300042601 Ga0466707_390721 Ga0466707_390721_343_1710 455
69 3300042616 Ga0466715_311238 Ga0466715_311238_384_1751 455
70 3300042655 Ga0466727_149072 Ga0466727_149072_569_1936 455
71 3300042655 Ga0466727_299839 Ga0466727_299839_10016_11383 455
72 3300005071 Ga0068302_10110289 Ga0068302_101102895 456
73 3300042593 Ga0466691_046826 Ga0466691_046826_503_1873 456
74 3300042596 Ga0466696_430965 Ga0466696_430965_194_1564 456
75 3300042602 Ga0466713_015314 Ga0466713_015314_14324_15694 456
76 3300042602 Ga0466713_017528 Ga0466713_017528_2509_3879 456
77 3300042605 Ga0466716_013915 Ga0466716_013915_1232_2602 456
78 3300042606 Ga0466719_006715 Ga0466719_006715_243_1613 456
79 3300042606 Ga0466719_142516 Ga0466719_142516_163_1533 456
80 3300042612 Ga0466705_261052 Ga0466705_261052_949_2319 456
81 3300042615 Ga0466711_089760 Ga0466711_089760_3552_4922 456
82 3300042616 Ga0466715_036672 Ga0466715_036672_5893_7263 456
83 3300042616 Ga0466715_528153 Ga0466715_528153_219_1589 456
84 3300042618 Ga0466723_087765 Ga0466723_087765_295_1665 456
85 3300042636 Ga0466703_167624 Ga0466703_167624_1086_2456 456
86 3300042652 Ga0466708_104343 Ga0466708_104343_3008_4378 456
87 3300042659 Ga0466733_094600 Ga0466733_094600_29789_31159 456
88 iso_pr_bacteria 2923982719 2923983244 456
89 iso_pr_bacteria 2940371297 2940373548 456
90 3300005083 Ga0068305_10183166 Ga0068305_101831663 457
91 3300042598 Ga0466701_061881 Ga0466701_061881_292_1665 457
92 3300042602 Ga0466713_040492 Ga0466713_040492_2962_4335 457
93 3300042605 Ga0466716_098196 Ga0466716_098196_3702_5075 457
94 3300042652 Ga0466708_467274 Ga0466708_467274_11372_12745 457
95 3300042596 Ga0466696_011057 Ga0466696_011057_3580_4956 458
96 3300042596 Ga0466696_203656 Ga0466696_203656_6571_7947 458
97 3300042602 Ga0466713_123288 Ga0466713_123288_73691_75067 458
98 3300042616 Ga0466715_165908 Ga0466715_165908_354_1730 458
99 3300042616 Ga0466715_300559 Ga0466715_300559_2141_3517 458
100 3300005083 Ga0068305_10096087 Ga0068305_100960874 460
101 3300042621 Ga0466729_180156 Ga0466729_180156_7281_8663 460
102 3300042636 Ga0466703_082612 Ga0466703_082612_26873_28255 460
103 3300042655 Ga0466727_037732 Ga0466727_037732_200_1582 460
104 3300042643 Ga0466704_329161 Ga0466704_329161_5976_7361 461
105 iso_pr_bacteria 2820209022 2820209442 461
106 3300002462 JGI24702J35022_10014961 JGI24702J35022_100149613 462
107 3300010167 Ga0123353_10156544 Ga0123353_101565442 462
108 3300042612 Ga0466705_007948 Ga0466705_007948_2765_4153 462
109 2225789004 2227499629 2227980868 463
110 iso_pr_bacteria 2940199050 2940199788 463
111 iso_pr_bacteria 2940209341 2940211527 463
112 iso_pr_bacteria 2940346213 2940348811 463
113 3300000062 IMNBL1DRAFT_c0000691 IMNBL1DRAFT_000069119 464
114 3300010167 Ga0123353_10088816 Ga0123353_100888162 464
115 3300010167 Ga0123353_10325258 Ga0123353_103252582 464
116 3300042615 Ga0466711_051950 Ga0466711_051950_3975_5369 464
117 3300042624 Ga0466735_055207 Ga0466735_055207_7027_8421 464
118 3300002462 JGI24702J35022_10020298 JGI24702J35022_100202982 465
119 iso_pr_bacteria 2864836148 2864837470 465
120 3300010167 Ga0123353_10062664 Ga0123353_100626642 466
121 3300042623 Ga0466734_108048 Ga0466734_108048_1312_2736 466
122 3300010167 Ga0123353_10109504 Ga0123353_101095042 467
123 iso_pr_bacteria 2820211246 2820213587 467
124 3300010049 Ga0123356_10000016 Ga0123356_1000001680 468
125 3300007140 Ga0102740_1000924 Ga0102740_10009246 470
126 3300042659 Ga0466733_103178 Ga0466733_103178_18236_19648 470
127 3300042654 Ga0466725_138136 Ga0466725_138136_322_1737 471
128 3300002462 JGI24702J35022_10001876 JGI24702J35022_100018766 472
129 3300042596 Ga0466696_207729 Ga0466696_207729_1383_2819 472
130 3300012837 Ga0160455_100004 Ga0160455_100004739 473
131 3300012848 Ga0160443_100026 Ga0160443_100026178 473
132 3300042624 Ga0466735_147318 Ga0466735_147318_1811_3232 473
133 3300012847 Ga0160445_100114 Ga0160445_10011436 474
134 3300042582 Ga0466657_259592 Ga0466657_259592_884_2308 474
135 3300012852 Ga0160430_105692 Ga0160430_1056923 477
136 3300010167 Ga0123353_10089054 Ga0123353_100890545 479
137 3300042606 Ga0466719_017423 Ga0466719_017423_7823_9265 480
138 3300042615 Ga0466711_305217 Ga0466711_305217_3454_4899 481
139 3300042620 Ga0466728_375768 Ga0466728_375768_2344_3831 495
140 3300042621 Ga0466729_101293 Ga0466729_101293_2226_3761 506
141 3300042615 Ga0466711_204841 Ga0466711_204841_3119_4912 526

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19051 GFO_IDH_MocA_C2 Oxidoreductase family, C-terminal alpha/beta domain 457 525 0.92
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 112 243 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01408 GO:0000166 nucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.