Protein Family IF07505

Metagenome Metatranscriptome Isolate
311 Members
91 Samples
277 Scaffolds
202.32 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_152238|Ga0466711_152238_690_1421
Length
243 aa
Sequence
LLNKRRRAIIGITLKSPHNTDQSDANQSAADKLRRRRVAVLVSGGGTNLQAIIDAKNGGKLPHVDIALVLSSDKNAFALERARKAGIENLALDVSDYTRNGVFDGERYDGDLLDALKKRGIEAVALAGFLVFLGEKTLSAYRSRIINVHPSLIPSFCGEGFHGLRVHEAALKRGVKITGATVHLVNEIIDGGRILSQKAVEVKSGDTPQTLQRRVMEKAEWIILPEALELLCAKAPPMPPLVQ

📊 Sample Types

Isolate 10.9%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.2%
Termitidae 31.5%
Kalotermitidae 14.6%
Termopsidae 4.5%
Rhinotermitidae 4.5%
Cambaridae 2.2%
Passalidae 2.2%
Hodotermitidae 1.1%
Blattidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 305
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
2 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
3 2820323050 Unclassified Firmicutes Nt197P3bin84 Isolate Unclassified
4 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
5 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
6 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
7 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
8 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
9 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
10 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
11 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
12 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
13 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
14 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
18 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
19 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
20 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
21 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
31 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
36 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
37 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
38 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
39 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
40 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
49 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
50 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
51 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
52 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
53 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
56 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
57 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
58 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
59 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
60 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
61 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
62 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
65 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
66 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
67 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
68 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
69 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
70 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
71 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
72 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
73 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
74 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
75 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
76 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
77 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
78 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
79 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
80 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
81 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
82 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
83 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
84 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
85 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
86 2820450073 Unclassified Firmicutes Lab288P3bin186 Isolate Unclassified
87 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
88 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
89 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
90 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
91 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_068463 3300042659 Bacteria 3386
2 Ga0466733_220381 3300042659 Bacteria 2389
3 Ga0466735_235169 3300042624 Bacteria 3530
4 Ga0466702_146668 3300042635 Bacteria 1970
5 Ga0466702_182349 3300042635 Bacteria 34499
6 Ga0466702_403336 3300042635 Bacteria 1900
7 Ga0466712_054472 3300042614 Bacteria 1504
8 Ga0466712_061400 3300042614 Bacteria 21098
9 Ga0123355_10055162 3300009826 Bacteria 6434
10 Ga0123355_10118327 3300009826 Bacteria 4117
11 Ga0123353_10061495 3300010167 Bacteria 6022
12 Ga0123353_10113379 3300010167 Bacteria 4364
13 Ga0123353_11137697 3300010167 Bacteria 1032
14 Ga0264413_100638 3300024493 Bacteria 13446
15 Ga0264413_113625 3300024493 Bacteria 11677
16 Ga0415639_135059 3300038395 Bacteria 3082
17 Ga0466693_351063 3300042592 Bacteria 21220
18 Ga0466694_108083 3300042594 Bacteria 54973
19 2227538517 2225789004 Bacteria 15888
20 JGI24695J34938_10001208 3300002450 Bacteria 22898
21 JGI24695J34938_10001953 3300002450 Bacteria 16543
22 Ga0072940_1008593 3300005200 Bacteria 2492
23 Ga0072941_1000754 3300005201 Bacteria 19604
24 Ga0466706_037893 3300042599 Bacteria 13008
25 Ga0466706_039169 3300042599 Bacteria 86401
26 Ga0466706_108689 3300042599 Bacteria 11416
27 Ga0466706_124534 3300042599 Bacteria 3575
28 Ga0466707_177929 3300042601 Bacteria 1059
29 Ga0466707_191602 3300042601 Bacteria 7400
30 Ga0466719_129749 3300042606 Bacteria 1318
31 Ga0466720_072526 3300042607 Bacteria 11119
32 Ga0466720_169414 3300042607 Bacteria 1406
33 Ga0466733_030262 3300042659 Bacteria 1723
34 Ga0466702_037243 3300042635 Bacteria 1547
35 Ga0466702_375469 3300042635 Bacteria 5267
36 Ga0466702_401638 3300042635 Bacteria 21442
37 Ga0466703_240951 3300042636 Bacteria 5347
38 Ga0466709_368918 3300042648 Bacteria 82197
39 Ga0466727_309638 3300042655 Bacteria 2569
40 Ga0466712_037672 3300042614 Bacteria 53460
41 Ga0466715_353878 3300042616 Bacteria 24649
42 Ga0466729_194729 3300042621 Bacteria 19933
43 Ga0123355_10000663 3300009826 Bacteria 46614
44 Ga0123356_10000141 3300010049 Bacteria 81679
45 Ga0123356_11432008 3300010049 Bacteria 850
46 Ga0123353_10106135 3300010167 Bacteria 4526
47 Ga0466695_402320 3300042595 Bacteria 61418
48 Ga0466696_412651 3300042596 Bacteria 1047
49 IMNBL1DRAFT_c0000002 3300000062 Bacteria 288751
50 AustNasuHG_c1010753 3300000089 Bacteria 3182
51 JGI24695J34938_10000571 3300002450 Bacteria 35414
52 JGI24695J34938_10045137 3300002450 Bacteria 1956
53 JGI24705J35276_12238445 3300002504 Bacteria 22433
54 Ga0072941_1030585 3300005201 Bacteria 7774
55 Ga0466706_052593 3300042599 Bacteria 32390
56 Ga0466706_263246 3300042599 Bacteria 7967
57 Ga0466707_021941 3300042601 Bacteria 3202
58 Ga0466707_109337 3300042601 Bacteria 1123
59 Ga0466707_120341 3300042601 Bacteria 52839
60 Ga0466713_069375 3300042602 Bacteria 56682
61 Ga0466716_057405 3300042605 Bacteria 4782
62 Ga0466698_029720 3300042610 Bacteria 4799
63 Ga0466697_203867 3300042611 Bacteria 1055
64 Ga0466705_385933 3300042612 Bacteria 1949
65 Ga0466733_061900 3300042659 Bacteria 2094
66 Ga0466702_428685 3300042635 Bacteria 1443
67 Ga0466703_022924 3300042636 Bacteria 31053
68 Ga0466708_210315 3300042652 Bacteria 30080
69 Ga0123355_10018894 3300009826 Bacteria 10959
70 Ga0123355_10260646 3300009826 Bacteria 2425
71 Ga0123356_10000496 3300010049 Bacteria 43882
72 Ga0123356_10067577 3300010049 Bacteria 3347
73 Ga0123356_10498839 3300010049 Bacteria 1373
74 Ga0123356_10615502 3300010049 Bacteria 1251
75 Ga0123353_10194178 3300010167 Unclassified 3201
76 Ga0123353_10447265 3300010167 Bacteria 1904
77 Ga0123353_10449822 3300010167 Bacteria 1897
78 Ga0123353_10717083 3300010167 Bacteria 1400
79 Ga0123353_11736985 3300010167 Bacteria 779
80 Ga0456237_0010849 3300041968 Bacteria 1339
81 Ga0466690_145503 3300042590 Bacteria 7345
82 Ga0466690_149737 3300042590 Bacteria 9356
83 Ga0466699_014912 3300042597 Bacteria 1184
84 Ga0466699_182129 3300042597 Bacteria 1022
85 AustNasuHG_c1000003 3300000089 Bacteria 67820
86 AustNasuHG_c1027663 3300000089 Bacteria 1721
87 JGI24698J34947_10025121 3300002449 Bacteria 3173
88 JGI24698J34947_10026716 3300002449 Bacteria 3066
89 JGI24698J34947_10035279 3300002449 Bacteria 2612
90 JGI24698J34947_10073457 3300002449 Bacteria 1632
91 JGI24695J34938_10000184 3300002450 Bacteria 58384
92 Ga0072940_1231841 3300005200 Bacteria 2734
93 Ga0072940_1350228 3300005200 Bacteria 3369
94 Ga0072941_1000053 3300005201 Bacteria 29032
95 Ga0072941_1001065 3300005201 Bacteria 17219
96 Ga0072941_1001353 3300005201 Bacteria 2803
97 Ga0072941_1014623 3300005201 Bacteria 8117
98 Ga0072941_1019661 3300005201 Bacteria 2560
99 Ga0074263_107438 3300005485 Unclassified 1705
100 Ga0074263_113139 3300005485 Bacteria 2162
101 Ga0466706_089283 3300042599 Bacteria 21669
102 Ga0466713_110078 3300042602 Bacteria 49332
103 Ga0466714_121040 3300042603 Bacteria 1479
104 Ga0466720_048697 3300042607 Bacteria 12458
105 Ga0466703_073400 3300042636 Bacteria 3596
106 Ga0466727_343570 3300042655 Bacteria 1317
107 Ga0466712_007834 3300042614 Bacteria 1290
108 Ga0466712_007944 3300042614 Bacteria 1006
109 Ga0466712_075059 3300042614 Bacteria 3715
110 Ga0466711_153149 3300042615 Bacteria 4567
111 Ga0466715_593419 3300042616 Bacteria 37491
112 Ga0466726_229879 3300042619 Bacteria 4148
113 Ga0123355_11054832 3300009826 Bacteria 853
114 Ga0123353_11000217 3300010167 Bacteria 1124
115 Ga0466699_032435 3300042597 Bacteria 1493
116 IMNBL1DRAFT_c0064539 3300000062 Bacteria 1083
117 AustNasuHG_c1038661 3300000089 Unclassified 1197
118 AustNasuHG_c1042571 3300000089 Bacteria 1079
119 AustNasuHG_c1047288 3300000089 Bacteria 961
120 JGI24698J34947_10027799 3300002449 Bacteria 3000
121 JGI24698J34947_10058761 3300002449 Bacteria 1903
122 JGI24695J34938_10000712 3300002450 Bacteria 31375
123 JGI24695J34938_10001776 3300002450 Bacteria 17795
124 JGI24695J34938_10005846 3300002450 Bacteria 7566
125 JGI24695J34938_10080398 3300002450 Bacteria 1347
126 Ga0068305_10002306 3300005083 Bacteria 48693
127 Ga0072941_1033313 3300005201 Bacteria 15549
128 Ga0466706_021872 3300042599 Bacteria 1150
129 Ga0466706_054768 3300042599 Bacteria 1265
130 Ga0466706_121873 3300042599 Bacteria 9273
131 Ga0466706_248288 3300042599 Bacteria 1113
132 Ga0466706_281818 3300042599 Bacteria 10894
133 Ga0466720_198278 3300042607 Bacteria 7843
134 Ga0466702_057328 3300042635 Bacteria 17553
135 Ga0466702_144479 3300042635 Bacteria 15823
136 Ga0466702_245015 3300042635 Bacteria 38015
137 Ga0466702_405566 3300042635 Bacteria 1513
138 Ga0466704_164591 3300042643 Bacteria 88701
139 Ga0466705_488230 3300042612 Bacteria 1978
140 Ga0466705_527466 3300042612 Bacteria 2652
141 Ga0466712_082610 3300042614 Bacteria 1355
142 Ga0466711_152238 3300042615 Bacteria 1805
143 Ga0466711_465454 3300042615 Bacteria 1655
144 Ga0466723_012210 3300042618 Bacteria 23081
145 Ga0466726_334779 3300042619 Bacteria 20203
146 Ga0123357_10144980 3300009784 Bacteria 2904
147 Ga0123356_10275567 3300010049 Bacteria 1774
148 Ga0123353_10240536 3300010167 Bacteria 2813
149 Ga0415639_031985 3300038395 Bacteria 4716
150 Ga0466694_155272 3300042594 Bacteria 2090
151 Ga0466694_319254 3300042594 Bacteria 1380
152 Ga0466694_396477 3300042594 Bacteria 4324
153 AustNasuHG_c1001055 3300000089 Bacteria 9904
154 AustNasuHG_c1042455 3300000089 Bacteria 1082
155 JGI24698J34947_10013872 3300002449 Bacteria 4394
156 Ga0072940_1020639 3300005200 Bacteria 1766
157 Ga0072941_1000593 3300005201 Bacteria 20958
158 Ga0072941_1004198 3300005201 Bacteria 11537
159 Ga0466706_028773 3300042599 Bacteria 5884
160 Ga0466706_122717 3300042599 Bacteria 10539
161 Ga0466706_127660 3300042599 Bacteria 10216
162 Ga0466706_183331 3300042599 Bacteria 69025
163 Ga0466706_193580 3300042599 Unclassified 1573
164 Ga0466706_206273 3300042599 Bacteria 43079
165 Ga0466714_086369 3300042603 Bacteria 40105
166 Ga0466720_045669 3300042607 Bacteria 12086
167 Ga0466722_074482 3300042609 Bacteria 2470
168 Ga0466722_126274 3300042609 Bacteria 25494
169 Ga0466733_034617 3300042659 Bacteria 1486
170 Ga0466729_283405 3300042621 Bacteria 59369
171 Ga0466702_125266 3300042635 Bacteria 1357
172 Ga0466704_089357 3300042643 Bacteria 7851
173 Ga0466712_018554 3300042614 Bacteria 1594
174 Ga0466712_090132 3300042614 Bacteria 2436
175 Ga0466718_031474 3300042617 Bacteria 13802
176 Ga0466726_218885 3300042619 Bacteria 9934
177 Ga0123357_10464989 3300009784 Bacteria 1083
178 Ga0123355_10375223 3300009826 Bacteria 1859
179 Ga0123356_10000086 3300010049 Bacteria 97047
180 Ga0123356_10000124 3300010049 Bacteria 85126
181 Ga0123356_10000198 3300010049 Bacteria 69577
182 Ga0123356_10000550 3300010049 Bacteria 41544
183 Ga0123356_10005761 3300010049 Bacteria 12572
184 Ga0123356_10022546 3300010049 Bacteria 5943
185 Ga0123356_10099673 3300010049 Bacteria 2785
186 Ga0123353_10199128 3300010167 Bacteria 3153
187 Ga0415639_013481 3300038395 Bacteria 3567
188 Ga0415639_027319 3300038395 Bacteria 6894
189 Ga0466692_170380 3300042591 Bacteria 33735
190 Ga0466693_047917 3300042592 Bacteria 41531
191 Ga0466691_154777 3300042593 Bacteria 3311
192 Ga0466699_025262 3300042597 Bacteria 91867
193 Ga0466699_037849 3300042597 Bacteria 7193
194 Ga0466699_250696 3300042597 Bacteria 8006
195 Ga0466699_318473 3300042597 Bacteria 1468
196 JGI24698J34947_10001283 3300002449 Bacteria 13145
197 JGI24698J34947_10010235 3300002449 Bacteria 5142
198 JGI24698J34947_10051270 3300002449 Bacteria 2076
199 JGI24705J35276_12131181 3300002504 Bacteria 1105
200 Ga0072941_1020449 3300005201 Bacteria 1964
201 Ga0466706_084867 3300042599 Bacteria 1320
202 Ga0466706_263820 3300042599 Bacteria 45787
203 Ga0466707_345759 3300042601 Bacteria 6137
204 Ga0466713_137118 3300042602 Bacteria 1773
205 Ga0466716_016179 3300042605 Unclassified 1631
206 Ga0466719_545440 3300042606 Bacteria 2333
207 Ga0466705_370031 3300042612 Bacteria 16318
208 Ga0466703_140310 3300042636 Bacteria 83054
209 Ga0466708_321485 3300042652 Bacteria 5135
210 Ga0466712_048555 3300042614 Bacteria 1606
211 Ga0466711_383912 3300042615 Bacteria 5370
212 Ga0466715_140184 3300042616 Bacteria 25565
213 Ga0466715_607828 3300042616 Bacteria 77672
214 Ga0466718_022445 3300042617 Bacteria 1339
215 Ga0466723_149738 3300042618 Bacteria 1873
216 Ga0123355_10069496 3300009826 Bacteria 5660
217 Ga0123356_10486433 3300010049 Bacteria 1388
218 Ga0123353_10433446 3300010167 Bacteria 1942
219 Ga0123353_10877070 3300010167 Bacteria 1225
220 Ga0255786_1035827 3300022815 Bacteria 2114
221 Ga0466691_087872 3300042593 Bacteria 2878
222 Ga0466691_128030 3300042593 Bacteria 5001
223 Ga0466696_208836 3300042596 Bacteria 44609
224 Ga0466699_228036 3300042597 Bacteria 1424
225 Ga0466699_261947 3300042597 Bacteria 1224
226 IMNBL1DRAFT_c0013597 3300000062 Bacteria 3640
227 JGI24698J34947_10008789 3300002449 Bacteria 5540
228 JGI24698J34947_10030621 3300002449 Bacteria 2837
229 JGI24695J34938_10000012 3300002450 Bacteria 126955
230 JGI24695J34938_10000322 3300002450 Bacteria 47194
231 Ga0068302_10063393 3300005071 Bacteria 2352
232 Ga0072940_1150488 3300005200 Bacteria 2250
233 Ga0072940_1171008 3300005200 Bacteria 2262
234 Ga0466706_193757 3300042599 Bacteria 1714
235 Ga0466706_203963 3300042599 Bacteria 2163
236 Ga0466706_264718 3300042599 Bacteria 2432
237 Ga0466707_109565 3300042601 Bacteria 3383
238 Ga0466707_194582 3300042601 Bacteria 13051
239 Ga0466707_260296 3300042601 Bacteria 3194
240 Ga0466719_308569 3300042606 Bacteria 54924
241 Ga0466721_174989 3300042608 Bacteria 226195
242 Ga0466733_193662 3300042659 Bacteria 14670
243 Ga0466727_122928 3300042655 Bacteria 1198
244 Ga0466712_071912 3300042614 Unclassified 1284
245 Ga0466712_233563 3300042614 Bacteria 7156
246 Ga0466718_015161 3300042617 Bacteria 9161
247 Ga0123357_10111179 3300009784 Bacteria 3492
248 Ga0123356_10029430 3300010049 Bacteria 5144
249 Ga0123356_10465727 3300010049 Bacteria 1414
250 Ga0123353_10108104 3300010167 Bacteria 4483
251 Ga0123353_10143523 3300010167 Bacteria 3822
252 Ga0123353_10538657 3300010167 Bacteria 1688
253 Ga0123354_10158136 3300010882 Bacteria 2707
254 Ga0466690_153730 3300042590 Bacteria 3897
255 Ga0466692_025052 3300042591 Bacteria 1380
256 Ga0466694_408106 3300042594 Bacteria 16751
257 2227272181 2225789004 Bacteria 1276
258 AustNasuHG_c1010347 3300000089 Bacteria 3252
259 JGI24698J34947_10070590 3300002449 Bacteria 1680
260 JGI24695J34938_10000015 3300002450 Bacteria 118711
261 JGI24695J34938_10001907 3300002450 Bacteria 16849
262 JGI24695J34938_10028857 3300002450 Bacteria 2601
263 Ga0072940_1016326 3300005200 Bacteria 7022
264 Ga0072940_1020637 3300005200 Bacteria 1151
265 Ga0072940_1282284 3300005200 Bacteria 2153
266 Ga0072941_1019088 3300005201 Bacteria 1692
267 Ga0074263_104523 3300005485 Bacteria 2047
268 Ga0466706_010096 3300042599 Bacteria 13391
269 Ga0466706_011257 3300042599 Bacteria 44160
270 Ga0466706_073310 3300042599 Bacteria 32772
271 Ga0466706_079547 3300042599 Bacteria 19358
272 Ga0466706_092349 3300042599 Bacteria 42995
273 Ga0466706_267431 3300042599 Bacteria 2055
274 Ga0466700_240199 3300042600 Bacteria 1168
275 Ga0466707_218240 3300042601 Bacteria 4301
276 Ga0466717_254114 3300042604 Bacteria 3148
277 Ga0466719_540595 3300042606 Bacteria 20921

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10194178 Ga0123353_101941782 172
2 3300010167 Ga0123353_10061495 Ga0123353_100614955 179
3 iso_pr_bacteria 2820431532 2820432793 184
4 3300005200 Ga0072940_1020639 Ga0072940_10206392 186
5 3300042614 Ga0466712_075059 Ga0466712_075059_16_597 193
6 iso_pr_bacteria 2820504582 2820505616 193
7 3300042599 Ga0466706_092349 Ga0466706_092349_15350_15934 194
8 3300042601 Ga0466707_218240 Ga0466707_218240_1082_1666 194
9 3300042609 Ga0466722_074482 Ga0466722_074482_686_1270 194
10 iso_pr_bacteria 2820280018 2820282826 194
11 3300009784 Ga0123357_10111179 Ga0123357_101111792 195
12 3300009784 Ga0123357_10144980 Ga0123357_101449801 195
13 3300010049 Ga0123356_10275567 Ga0123356_102755671 195
14 3300042599 Ga0466706_010096 Ga0466706_010096_1172_1759 195
15 3300042599 Ga0466706_011257 Ga0466706_011257_5157_5744 195
16 3300042599 Ga0466706_037893 Ga0466706_037893_1030_1617 195
17 3300042599 Ga0466706_079547 Ga0466706_079547_13415_14002 195
18 3300042599 Ga0466706_084867 Ga0466706_084867_231_818 195
19 3300042599 Ga0466706_089283 Ga0466706_089283_15523_16110 195
20 3300042599 Ga0466706_108689 Ga0466706_108689_6611_7198 195
21 3300042599 Ga0466706_121873 Ga0466706_121873_6477_7064 195
22 3300042599 Ga0466706_122717 Ga0466706_122717_5819_6406 195
23 3300042599 Ga0466706_193580 Ga0466706_193580_741_1328 195
24 3300042599 Ga0466706_193757 Ga0466706_193757_104_691 195
25 3300042599 Ga0466706_203963 Ga0466706_203963_1109_1696 195
26 3300042599 Ga0466706_206273 Ga0466706_206273_3250_3837 195
27 3300042599 Ga0466706_263246 Ga0466706_263246_3773_4360 195
28 3300042601 Ga0466707_120341 Ga0466707_120341_7700_8287 195
29 3300042617 Ga0466718_031474 Ga0466718_031474_5031_5618 195
30 3300042624 Ga0466735_235169 Ga0466735_235169_1244_1831 195
31 3300042635 Ga0466702_245015 Ga0466702_245015_16103_16690 195
32 3300042636 Ga0466703_022924 Ga0466703_022924_16672_17259 195
33 iso_pr_bacteria 2940228231 2940228834 195
34 3300042597 Ga0466699_037849 Ga0466699_037849_3324_3914 196
35 3300042597 Ga0466699_261947 Ga0466699_261947_395_985 196
36 3300042599 Ga0466706_052593 Ga0466706_052593_28796_29386 196
37 3300042599 Ga0466706_281818 Ga0466706_281818_9117_9707 196
38 3300042601 Ga0466707_191602 Ga0466707_191602_4261_4851 196
39 3300042609 Ga0466722_126274 Ga0466722_126274_21909_22499 196
40 2225789004 2227272181 2227721513 197
41 2225789004 2227538517 2228058010 197
42 3300000062 IMNBL1DRAFT_c0064539 IMNBL1DRAFT_00645392 197
43 3300000089 AustNasuHG_c1010753 AustNasuHG_10107534 197
44 3300005201 Ga0072941_1020449 Ga0072941_10204492 197
45 3300010167 Ga0123353_11000217 Ga0123353_110002172 197
46 3300038395 Ga0415639_013481 Ga0415639_013481_2278_2871 197
47 3300042591 Ga0466692_025052 Ga0466692_025052_249_842 197
48 3300042592 Ga0466693_351063 Ga0466693_351063_13305_13898 197
49 3300042594 Ga0466694_319254 Ga0466694_319254_684_1277 197
50 3300042596 Ga0466696_208836 Ga0466696_208836_20729_21322 197
51 3300042597 Ga0466699_014912 Ga0466699_014912_319_912 197
52 3300042597 Ga0466699_032435 Ga0466699_032435_653_1246 197
53 3300042597 Ga0466699_182129 Ga0466699_182129_267_860 197
54 3300042597 Ga0466699_228036 Ga0466699_228036_590_1183 197
55 3300042597 Ga0466699_250696 Ga0466699_250696_3325_3918 197
56 3300042597 Ga0466699_318473 Ga0466699_318473_773_1366 197
57 3300042599 Ga0466706_073310 Ga0466706_073310_8690_9283 197
58 3300042601 Ga0466707_109565 Ga0466707_109565_1162_1755 197
59 3300042605 Ga0466716_057405 Ga0466716_057405_2526_3119 197
60 3300042606 Ga0466719_540595 Ga0466719_540595_871_1464 197
61 3300042616 Ga0466715_140184 Ga0466715_140184_19071_19664 197
62 3300042616 Ga0466715_607828 Ga0466715_607828_16227_16820 197
63 3300042617 Ga0466718_022445 Ga0466718_022445_368_961 197
64 3300042635 Ga0466702_401638 Ga0466702_401638_9176_9769 197
65 3300042635 Ga0466702_428685 Ga0466702_428685_754_1347 197
66 3300042643 Ga0466704_089357 Ga0466704_089357_6467_7060 197
67 3300042659 Ga0466733_034617 Ga0466733_034617_693_1286 197
68 3300042659 Ga0466733_068463 Ga0466733_068463_167_760 197
69 iso_pr_bacteria 2781125638 2781283654 197
70 iso_pr_bacteria 2781125643 2781293706 197
71 iso_pr_bacteria 2781125659 2781326779 197
72 iso_pr_bacteria 2820492969 2820495253 197
73 3300000062 IMNBL1DRAFT_c0000002 IMNBL1DRAFT_0000002246 198
74 3300002450 JGI24695J34938_10000015 JGI24695J34938_1000001531 198
75 3300002450 JGI24695J34938_10000184 JGI24695J34938_1000018428 198
76 3300002450 JGI24695J34938_10001907 JGI24695J34938_1000190711 198
77 3300002450 JGI24695J34938_10005846 JGI24695J34938_100058466 198
78 3300005200 Ga0072940_1231841 Ga0072940_12318412 198
79 3300010049 Ga0123356_10000550 Ga0123356_1000055010 198
80 3300010049 Ga0123356_10029430 Ga0123356_100294304 198
81 3300010049 Ga0123356_11432008 Ga0123356_114320081 198
82 3300010167 Ga0123353_10106135 Ga0123353_101061353 198
83 3300010167 Ga0123353_11137697 Ga0123353_111376972 198
84 3300022815 Ga0255786_1035827 Ga0255786_10358272 198
85 3300024493 Ga0264413_100638 Ga0264413_1006388 198
86 3300024493 Ga0264413_113625 Ga0264413_1136254 198
87 3300038395 Ga0415639_135059 Ga0415639_135059_103_699 198
88 3300042594 Ga0466694_155272 Ga0466694_155272_670_1266 198
89 3300042597 Ga0466699_025262 Ga0466699_025262_19833_20429 198
90 3300042599 Ga0466706_263820 Ga0466706_263820_39517_40113 198
91 3300042601 Ga0466707_109337 Ga0466707_109337_220_816 198
92 3300042605 Ga0466716_016179 Ga0466716_016179_705_1301 198
93 3300042607 Ga0466720_045669 Ga0466720_045669_18_614 198
94 3300042607 Ga0466720_048697 Ga0466720_048697_7797_8393 198
95 3300042607 Ga0466720_072526 Ga0466720_072526_18_614 198
96 3300042607 Ga0466720_169414 Ga0466720_169414_506_1102 198
97 3300042607 Ga0466720_198278 Ga0466720_198278_5391_5987 198
98 3300042610 Ga0466698_029720 Ga0466698_029720_960_1556 198
99 3300042614 Ga0466712_018554 Ga0466712_018554_272_868 198
100 3300042614 Ga0466712_071912 Ga0466712_071912_279_875 198
101 3300042619 Ga0466726_218885 Ga0466726_218885_8361_8957 198
102 3300042635 Ga0466702_037243 Ga0466702_037243_841_1437 198
103 3300042635 Ga0466702_125266 Ga0466702_125266_562_1158 198
104 3300042635 Ga0466702_146668 Ga0466702_146668_1241_1837 198
105 3300042635 Ga0466702_182349 Ga0466702_182349_12673_13269 198
106 3300042635 Ga0466702_375469 Ga0466702_375469_468_1064 198
107 iso_pr_bacteria 2781125635 2781277173 198
108 iso_pr_bacteria 2781125645 2781298815 198
109 iso_pr_bacteria 2781125657 2781322973 198
110 iso_pr_bacteria 2781125660 2781331396 198
111 iso_pr_bacteria 2781125661 2781332435 198
112 iso_pr_bacteria 2781125664 2781339968 198
113 iso_pr_bacteria 2819992462 2819992983 198
114 iso_pr_bacteria 2820323050 2820323190 198
115 iso_pr_bacteria 2820483401 2820485486 198
116 3300000089 AustNasuHG_c1001055 AustNasuHG_100105510 199
117 3300000089 AustNasuHG_c1010347 AustNasuHG_10103472 199
118 3300000089 AustNasuHG_c1027663 AustNasuHG_10276632 199
119 3300000089 AustNasuHG_c1038661 AustNasuHG_10386612 199
120 3300000089 AustNasuHG_c1042455 AustNasuHG_10424552 199
121 3300000089 AustNasuHG_c1042571 AustNasuHG_10425712 199
122 3300000089 AustNasuHG_c1047288 AustNasuHG_10472882 199
123 3300002449 JGI24698J34947_10008789 JGI24698J34947_100087896 199
124 3300002449 JGI24698J34947_10010235 JGI24698J34947_100102353 199
125 3300002449 JGI24698J34947_10013872 JGI24698J34947_100138724 199
126 3300002449 JGI24698J34947_10025121 JGI24698J34947_100251211 199
127 3300002449 JGI24698J34947_10026716 JGI24698J34947_100267162 199
128 3300002449 JGI24698J34947_10027799 JGI24698J34947_100277994 199
129 3300002449 JGI24698J34947_10030621 JGI24698J34947_100306212 199
130 3300002449 JGI24698J34947_10035279 JGI24698J34947_100352792 199
131 3300002450 JGI24695J34938_10000012 JGI24695J34938_100000129 199
132 3300002450 JGI24695J34938_10000322 JGI24695J34938_100003226 199
133 3300002450 JGI24695J34938_10000571 JGI24695J34938_100005719 199
134 3300002450 JGI24695J34938_10001953 JGI24695J34938_100019533 199
135 3300005200 Ga0072940_1008593 Ga0072940_10085932 199
136 3300005200 Ga0072940_1016326 Ga0072940_10163262 199
137 3300005201 Ga0072941_1000053 Ga0072941_10000531 199
138 3300005201 Ga0072941_1000593 Ga0072941_100059321 199
139 3300005201 Ga0072941_1001353 Ga0072941_10013533 199
140 3300005201 Ga0072941_1004198 Ga0072941_10041983 199
141 3300005201 Ga0072941_1019088 Ga0072941_10190882 199
142 3300005201 Ga0072941_1019661 Ga0072941_10196613 199
143 3300005485 Ga0074263_104523 Ga0074263_1045232 199
144 3300005485 Ga0074263_107438 Ga0074263_1074382 199
145 3300009826 Ga0123355_10375223 Ga0123355_103752232 199
146 3300010049 Ga0123356_10000086 Ga0123356_1000008622 199
147 3300010049 Ga0123356_10000124 Ga0123356_100001248 199
148 3300010049 Ga0123356_10000198 Ga0123356_1000019852 199
149 3300010049 Ga0123356_10000496 Ga0123356_1000049624 199
150 3300010049 Ga0123356_10005761 Ga0123356_100057619 199
151 3300010049 Ga0123356_10022546 Ga0123356_100225465 199
152 3300010049 Ga0123356_10067577 Ga0123356_100675772 199
153 3300010049 Ga0123356_10465727 Ga0123356_104657272 199
154 3300010049 Ga0123356_10486433 Ga0123356_104864332 199
155 3300010049 Ga0123356_10498839 Ga0123356_104988392 199
156 3300010167 Ga0123353_10538657 Ga0123353_105386572 199
157 3300042592 Ga0466693_047917 Ga0466693_047917_2228_2827 199
158 3300042599 Ga0466706_264718 Ga0466706_264718_177_776 199
159 3300042600 Ga0466700_240199 Ga0466700_240199_537_1136 199
160 3300042602 Ga0466713_137118 Ga0466713_137118_471_1070 199
161 3300042614 Ga0466712_007834 Ga0466712_007834_280_879 199
162 3300042614 Ga0466712_037672 Ga0466712_037672_1234_1833 199
163 3300042614 Ga0466712_054472 Ga0466712_054472_727_1326 199
164 3300042617 Ga0466718_015161 Ga0466718_015161_523_1122 199
165 3300042635 Ga0466702_403336 Ga0466702_403336_877_1476 199
166 3300042655 Ga0466727_343570 Ga0466727_343570_161_760 199
167 3300002450 JGI24695J34938_10028857 JGI24695J34938_100288572 200
168 3300002450 JGI24695J34938_10080398 JGI24695J34938_100803982 200
169 3300005201 Ga0072941_1033313 Ga0072941_103331312 200
170 3300005485 Ga0074263_113139 Ga0074263_1131392 200
171 3300009826 Ga0123355_10000663 Ga0123355_1000066335 200
172 3300009826 Ga0123355_10055162 Ga0123355_100551625 200
173 3300009826 Ga0123355_10069496 Ga0123355_100694965 200
174 3300042594 Ga0466694_396477 Ga0466694_396477_3554_4156 200
175 3300042601 Ga0466707_194582 Ga0466707_194582_170_772 200
176 3300042601 Ga0466707_260296 Ga0466707_260296_2388_2990 200
177 3300042601 Ga0466707_345759 Ga0466707_345759_2407_3009 200
178 3300042602 Ga0466713_110078 Ga0466713_110078_36284_36886 200
179 3300042608 Ga0466721_174989 Ga0466721_174989_149609_150211 200
180 3300042616 Ga0466715_593419 Ga0466715_593419_8799_9401 200
181 3300042619 Ga0466726_334779 Ga0466726_334779_5278_5880 200
182 3300042621 Ga0466729_283405 Ga0466729_283405_9318_9920 200
183 3300042635 Ga0466702_057328 Ga0466702_057328_843_1445 200
184 3300042635 Ga0466702_144479 Ga0466702_144479_13231_13833 200
185 3300042648 Ga0466709_368918 Ga0466709_368918_19595_20197 200
186 iso_pr_bacteria 2820356982 2820357893 200
187 iso_pr_bacteria 2909881144 2909882799 200
188 iso_pr_bacteria 2910090113 2910092136 200
189 3300002450 JGI24695J34938_10001776 JGI24695J34938_100017764 201
190 3300005083 Ga0068305_10002306 Ga0068305_1000230614 201
191 3300005201 Ga0072941_1014623 Ga0072941_10146236 201
192 3300009826 Ga0123355_10260646 Ga0123355_102606462 201
193 3300009826 Ga0123355_11054832 Ga0123355_110548321 201
194 3300010167 Ga0123353_10199128 Ga0123353_101991283 201
195 3300010167 Ga0123353_10717083 Ga0123353_107170831 201
196 3300042594 Ga0466694_408106 Ga0466694_408106_14550_15155 201
197 3300042614 Ga0466712_007944 Ga0466712_007944_167_772 201
198 iso_pr_bacteria 2781125634 2781275685 201
199 iso_pr_bacteria 2820240463 2820242102 201
200 iso_pr_bacteria 2820265624 2820265829 201
201 iso_pr_bacteria 2820450073 2820451119 201
202 3300002449 JGI24698J34947_10051270 JGI24698J34947_100512702 202
203 3300005071 Ga0068302_10063393 Ga0068302_100633932 202
204 3300010167 Ga0123353_10449822 Ga0123353_104498222 202
205 3300038395 Ga0415639_031985 Ga0415639_031985_3065_3673 202
206 3300042596 Ga0466696_412651 Ga0466696_412651_356_994 202
207 3300042599 Ga0466706_021872 Ga0466706_021872_345_953 202
208 3300042601 Ga0466707_021941 Ga0466707_021941_651_1259 202
209 3300042602 Ga0466713_069375 Ga0466713_069375_7287_7895 202
210 3300042615 Ga0466711_383912 Ga0466711_383912_977_1585 202
211 3300042615 Ga0466711_465454 Ga0466711_465454_922_1530 202
212 3300042655 Ga0466727_122928 Ga0466727_122928_259_867 202
213 3300042659 Ga0466733_030262 Ga0466733_030262_351_959 202
214 iso_pr_bacteria 2820495292 2820496359 202
215 3300010049 Ga0123356_10000141 Ga0123356_1000014167 203
216 3300010049 Ga0123356_10099673 Ga0123356_100996732 203
217 3300010167 Ga0123353_10447265 Ga0123353_104472652 203
218 3300042604 Ga0466717_254114 Ga0466717_254114_1615_2226 203
219 3300042619 Ga0466726_229879 Ga0466726_229879_2869_3480 203
220 3300002450 JGI24695J34938_10045137 JGI24695J34938_100451372 204
221 3300009826 Ga0123355_10018894 Ga0123355_1001889412 204
222 3300042594 Ga0466694_108083 Ga0466694_108083_27727_28341 204
223 3300042636 Ga0466703_240951 Ga0466703_240951_3326_3940 204
224 iso_pr_bacteria 2781125650 2781308639 204
225 iso_pr_bacteria 2820340373 2820341435 204
226 3300002450 JGI24695J34938_10000712 JGI24695J34938_1000071223 205
227 3300010167 Ga0123353_10433446 Ga0123353_104334462 205
228 3300038395 Ga0415639_027319 Ga0415639_027319_5835_6452 205
229 3300042599 Ga0466706_183331 Ga0466706_183331_35178_35795 205
230 3300042601 Ga0466707_177929 Ga0466707_177929_304_921 205
231 3300042614 Ga0466712_233563 Ga0466712_233563_6056_6673 205
232 3300042655 Ga0466727_309638 Ga0466727_309638_1842_2459 205
233 3300042659 Ga0466733_061900 Ga0466733_061900_1463_2080 205
234 iso_pr_bacteria 2820312173 2820313870 205
235 3300002504 JGI24705J35276_12131181 JGI24705J35276_121311811 206
236 3300002504 JGI24705J35276_12238445 JGI24705J35276_1223844512 206
237 3300005201 Ga0072941_1001065 Ga0072941_10010653 206
238 3300042599 Ga0466706_028773 Ga0466706_028773_1250_1870 206
239 3300042599 Ga0466706_124534 Ga0466706_124534_2536_3156 206
240 3300042606 Ga0466719_129749 Ga0466719_129749_159_779 206
241 3300010167 Ga0123353_10240536 Ga0123353_102405362 207
242 3300042599 Ga0466706_054768 Ga0466706_054768_483_1106 207
243 3300042614 Ga0466712_048555 Ga0466712_048555_549_1172 207
244 3300042614 Ga0466712_061400 Ga0466712_061400_15632_16255 207
245 iso_pr_bacteria 2820275298 2820276583 207
246 3300009826 Ga0123355_10118327 Ga0123355_101183273 208
247 3300010167 Ga0123353_10877070 Ga0123353_108770702 208
248 3300042593 Ga0466691_087872 Ga0466691_087872_266_892 208
249 3300042599 Ga0466706_127660 Ga0466706_127660_8220_8846 208
250 3300042612 Ga0466705_385933 Ga0466705_385933_489_1115 208
251 3300005200 Ga0072940_1150488 Ga0072940_11504882 209
252 3300005200 Ga0072940_1350228 Ga0072940_13502283 209
253 3300042603 Ga0466714_086369 Ga0466714_086369_9882_10511 209
254 3300042621 Ga0466729_194729 Ga0466729_194729_17216_17845 209
255 3300000089 AustNasuHG_c1000003 AustNasuHG_100000310 210
256 3300002450 JGI24695J34938_10001208 JGI24695J34938_1000120810 210
257 3300005200 Ga0072940_1282284 Ga0072940_12822842 210
258 3300010167 Ga0123353_11736985 Ga0123353_117369851 210
259 3300042603 Ga0466714_121040 Ga0466714_121040_425_1057 210
260 3300042612 Ga0466705_527466 Ga0466705_527466_760_1392 210
261 3300042614 Ga0466712_090132 Ga0466712_090132_1385_2017 210
262 3300042618 Ga0466723_149738 Ga0466723_149738_290_922 210
263 3300042635 Ga0466702_405566 Ga0466702_405566_463_1095 210
264 iso_pr_bacteria 2820272499 2820272610 210
265 3300000062 IMNBL1DRAFT_c0013597 IMNBL1DRAFT_00135972 211
266 3300002449 JGI24698J34947_10001283 JGI24698J34947_100012836 211
267 3300002449 JGI24698J34947_10070590 JGI24698J34947_100705902 211
268 3300042590 Ga0466690_145503 Ga0466690_145503_5791_6426 211
269 3300042590 Ga0466690_153730 Ga0466690_153730_1609_2244 211
270 3300042599 Ga0466706_039169 Ga0466706_039169_400_1035 211
271 3300042612 Ga0466705_488230 Ga0466705_488230_195_830 211
272 3300042616 Ga0466715_353878 Ga0466715_353878_11386_12021 211
273 3300042636 Ga0466703_073400 Ga0466703_073400_450_1085 211
274 3300002449 JGI24698J34947_10073457 JGI24698J34947_100734572 212
275 3300005200 Ga0072940_1020637 Ga0072940_10206372 212
276 3300042593 Ga0466691_128030 Ga0466691_128030_3020_3658 212
277 3300042636 Ga0466703_140310 Ga0466703_140310_76861_77499 212
278 3300042643 Ga0466704_164591 Ga0466704_164591_71686_72324 212
279 3300005201 Ga0072941_1030585 Ga0072941_103058510 213
280 3300042593 Ga0466691_154777 Ga0466691_154777_2145_2786 213
281 3300042618 Ga0466723_012210 Ga0466723_012210_15010_15651 213
282 3300005201 Ga0072941_1000754 Ga0072941_10007544 214
283 3300010167 Ga0123353_10113379 Ga0123353_101133793 214
284 3300042606 Ga0466719_545440 Ga0466719_545440_1431_2075 214
285 3300042652 Ga0466708_321485 Ga0466708_321485_1381_2025 214
286 3300005200 Ga0072940_1171008 Ga0072940_11710083 215
287 3300042611 Ga0466697_203867 Ga0466697_203867_17_664 215
288 3300042612 Ga0466705_370031 Ga0466705_370031_7977_8624 215
289 iso_pr_bacteria 2820460928 2820461746 215
290 3300010167 Ga0123353_10143523 Ga0123353_101435233 216
291 3300042599 Ga0466706_267431 Ga0466706_267431_1094_1744 216
292 3300009784 Ga0123357_10464989 Ga0123357_104649892 217
293 3300042599 Ga0466706_248288 Ga0466706_248288_182_835 217
294 3300042606 Ga0466719_308569 Ga0466719_308569_16262_16915 217
295 3300042659 Ga0466733_193662 Ga0466733_193662_1837_2490 217
296 3300042659 Ga0466733_220381 Ga0466733_220381_145_798 217
297 iso_pr_bacteria 2820507989 2820509842 217
298 3300042614 Ga0466712_082610 Ga0466712_082610_643_1305 220
299 3300002449 JGI24698J34947_10058761 JGI24698J34947_100587612 221
300 3300042591 Ga0466692_170380 Ga0466692_170380_13539_14204 221
301 3300042595 Ga0466695_402320 Ga0466695_402320_25639_26307 222
302 iso_pr_bacteria 2820403592 2820404912 223
303 3300010049 Ga0123356_10615502 Ga0123356_106155021 224
304 3300010882 Ga0123354_10158136 Ga0123354_101581362 224
305 3300041968 Ga0456237_0010849 Ga0456237_0010849_133_819 228
306 3300042615 Ga0466711_153149 Ga0466711_153149_517_1251 229
307 iso_pr_bacteria 2820447167 2820448779 231
308 3300010167 Ga0123353_10108104 Ga0123353_101081042 232
309 3300042652 Ga0466708_210315 Ga0466708_210315_20242_20958 238
310 3300042590 Ga0466690_149737 Ga0466690_149737_1048_1770 240
311 3300042615 Ga0466711_152238 Ga0466711_152238_690_1421 243

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00551 Formyl_trans_N Formyl transferase 37 227 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00551 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.