Protein Family IF07502

Metagenome Isolate
169 Members
55 Samples
165 Scaffolds
432.09 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_148907|Ga0466711_148907_1673_3061
Length
462 aa
Sequence
MRMPEIEYQPLEVIRHFQEKKLAGALEYLSRFSPFYRRMFAENRIDVAKIRTIADLQQIPFTEKSALQSHNDEFLCVARHKIIDYITTSGTLGDPATFAMTDADLDRLAYNEKISFECAGAEPGDIFQLMTTIDKRFMAGLAYFLGVRKLGAGIIRVGNGIPELQWDTIRRIKPNTIIVVPSFILKIIRYAEEHGIDHRASSVKKAICIGENLREQDFSLNLLGKSIREKWGIELYSTYASTEMATTFTECAFGCGGHHHPELIICELADENGRPVAEGETGELVVTTLGVEGMPLLRFRTGDLARFHREPCRCGRTSMRISPIVGRKDHMVKYKGTSLYPPAVFDVLDNTSYVENYVMVVSDNECGNDHVLVLAGLREPPGYDAVKDLKDRFRARIRVAPDVEIRPAEEIRKINFPDTSRKPVKFIDRRKAANHHSITNNQQSTINWKINSKTSAPTGNRK

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.5%
Kalotermitidae 25.5%
Unclassified 12.7%
Rhinotermitidae 5.5%
Termopsidae 5.5%
Passalidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
45 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
49 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_031057 3300042598 Bacteria 34075
2 Ga0466707_376420 3300042601 Bacteria 22118
3 Ga0466722_125521 3300042609 Bacteria 16603
4 Ga0466722_240676 3300042609 Bacteria 6364
5 Ga0466656_120950 3300042550 Bacteria 9575
6 Ga0466690_087674 3300042590 Bacteria 3777
7 Ga0466690_159618 3300042590 Bacteria 13151
8 Ga0466693_081870 3300042592 Bacteria 3434
9 Ga0466693_344935 3300042592 Bacteria 4143
10 Ga0466691_028335 3300042593 Bacteria 20105
11 Ga0123356_10038011 3300010049 Bacteria 4488
12 Ga0123354_10001016 3300010882 Bacteria 32074
13 IMNBL1DRAFT_c0001686 3300000062 Bacteria 16300
14 JGI24705J35276_12237354 3300002504 Bacteria 10794
15 JGI24696J40584_12961651 3300002834 Bacteria 28246
16 Ga0466702_345415 3300042635 Bacteria 2239
17 Ga0466709_159378 3300042648 Unclassified 18288
18 Ga0466705_191068 3300042612 Bacteria 8850
19 Ga0466715_125107 3300042616 Bacteria 14722
20 Ga0466715_503781 3300042616 Bacteria 29674
21 Ga0466728_289451 3300042620 Bacteria 3826
22 Ga0466707_150969 3300042601 Bacteria 29136
23 Ga0466707_418710 3300042601 Bacteria 3498
24 Ga0466717_274538 3300042604 Bacteria 1796
25 Ga0466733_055799 3300042659 Bacteria 106016
26 Ga0466690_015023 3300042590 Bacteria 27335
27 Ga0466692_046708 3300042591 Bacteria 150257
28 Ga0466696_165406 3300042596 Bacteria 15212
29 Ga0123354_10213450 3300010882 Bacteria 2076
30 IMNBL1DRAFT_c0003394 3300000062 Bacteria 10288
31 Ga0466735_169084 3300042624 Bacteria 1905
32 Ga0466708_066817 3300042652 Bacteria 5930
33 Ga0466715_015212 3300042616 Bacteria 6907
34 Ga0466715_194603 3300042616 Bacteria 47231
35 Ga0466726_048716 3300042619 Bacteria 3996
36 Ga0466726_165838 3300042619 Bacteria 6943
37 Ga0466701_095924 3300042598 Bacteria 1588
38 Ga0466707_063453 3300042601 Bacteria 7168
39 Ga0466716_347766 3300042605 Bacteria 17678
40 Ga0466719_160806 3300042606 Bacteria 8437
41 Ga0466719_378540 3300042606 Bacteria 3455
42 Ga0466722_006441 3300042609 Bacteria 9912
43 Ga0466722_012804 3300042609 Bacteria 32142
44 Ga0466722_021911 3300042609 Bacteria 53346
45 Ga0466733_138584 3300042659 Bacteria 8998
46 Ga0123353_10008324 3300010167 Bacteria 14147
47 IMNBL1DRAFT_c0006837 3300000062 Bacteria 6139
48 JGI24702J35022_10016164 3300002462 Bacteria 4095
49 JGI24702J35022_10024361 3300002462 Bacteria 3271
50 Ga0466735_181813 3300042624 Bacteria 1900
51 Ga0466703_013908 3300042636 Bacteria 8602
52 Ga0466703_135729 3300042636 Bacteria 12462
53 Ga0466704_252042 3300042643 Bacteria 16478
54 Ga0466709_248020 3300042648 Bacteria 6283
55 Ga0466727_172844 3300042655 Bacteria 7424
56 Ga0466697_167564 3300042611 Bacteria 10903
57 Ga0466715_042761 3300042616 Bacteria 45810
58 Ga0466718_069150 3300042617 Bacteria 1416
59 Ga0466723_335450 3300042618 Bacteria 9017
60 Ga0466726_089813 3300042619 Bacteria 6693
61 Ga0466706_017077 3300042599 Bacteria 10233
62 Ga0466713_086346 3300042602 Bacteria 12025
63 Ga0466698_328155 3300042610 Bacteria 1774
64 Ga0466732_232142 3300042656 Bacteria 5930
65 Ga0466690_048418 3300042590 Bacteria 7719
66 Ga0466692_013440 3300042591 Bacteria 17179
67 Ga0123353_10000594 3300010167 Bacteria 44270
68 Ga0123353_10001069 3300010167 Bacteria 33407
69 Ga0123354_10083678 3300010882 Bacteria 4487
70 JGI24702J35022_10042718 3300002462 Bacteria 2414
71 JGI24696J40584_12960642 3300002834 Bacteria 7898
72 Ga0466731_358898 3300042622 Bacteria 87251
73 Ga0466703_021000 3300042636 Bacteria 8203
74 Ga0466704_002372 3300042643 Bacteria 57196
75 Ga0466704_021495 3300042643 Bacteria 17158
76 Ga0466704_374722 3300042643 Bacteria 19201
77 Ga0466711_148907 3300042615 Bacteria 10787
78 Ga0466711_213686 3300042615 Bacteria 7431
79 Ga0466711_272661 3300042615 Bacteria 4675
80 Ga0466723_010958 3300042618 Bacteria 5683
81 Ga0466723_277765 3300042618 Bacteria 43175
82 Ga0466726_312321 3300042619 Bacteria 1659
83 Ga0466728_278714 3300042620 Bacteria 5281
84 Ga0466713_038812 3300042602 Bacteria 13025
85 Ga0466722_139334 3300042609 Bacteria 3070
86 Ga0466733_212465 3300042659 Bacteria 4832
87 Ga0466690_313164 3300042590 Bacteria 2366
88 Ga0466696_091816 3300042596 Bacteria 11965
89 Ga0123353_10649737 3300010167 Bacteria 1493
90 Ga0123354_10172874 3300010882 Bacteria 2505
91 Ga0068305_10057746 3300005083 Unclassified 11121
92 Ga0466729_268864 3300042621 Bacteria 19528
93 Ga0466702_009416 3300042635 Bacteria 1281
94 Ga0466704_024801 3300042643 Bacteria 23494
95 Ga0466709_273462 3300042648 Bacteria 4001
96 Ga0466708_130167 3300042652 Bacteria 53436
97 Ga0466727_051328 3300042655 Bacteria 9580
98 Ga0466712_298084 3300042614 Bacteria 4121
99 Ga0466715_388028 3300042616 Bacteria 11694
100 Ga0466723_320199 3300042618 Bacteria 12571
101 Ga0466726_172879 3300042619 Bacteria 6101
102 Ga0466713_017736 3300042602 Bacteria 49462
103 Ga0466713_117267 3300042602 Bacteria 44157
104 Ga0466717_270688 3300042604 Bacteria 1700
105 Ga0466716_257662 3300042605 Bacteria 29731
106 Ga0415639_077064 3300038395 Bacteria 2743
107 Ga0466657_389727 3300042582 Bacteria 2347
108 Ga0466690_126381 3300042590 Bacteria 12143
109 Ga0466692_001428 3300042591 Bacteria 2263
110 Ga0466696_120177 3300042596 Bacteria 12396
111 Ga0466696_305108 3300042596 Bacteria 6709
112 Ga0466696_340248 3300042596 Bacteria 11516
113 Ga0123356_10048427 3300010049 Bacteria 3956
114 Ga0123356_10399586 3300010049 Bacteria 1511
115 Ga0123353_10104475 3300010167 Bacteria 4565
116 Ga0123354_10168668 3300010882 Bacteria 2559
117 JGI24702J35022_10000054 3300002462 Bacteria 48095
118 JGI24702J35022_10007616 3300002462 Bacteria 6194
119 Ga0123357_10000257 3300009784 Bacteria 50946
120 Ga0466734_160465 3300042623 Bacteria 1516
121 Ga0466703_399369 3300042636 Bacteria 29558
122 Ga0466704_163818 3300042643 Bacteria 2579
123 Ga0466705_105693 3300042612 Bacteria 24317
124 Ga0466705_267691 3300042612 Bacteria 7907
125 Ga0466710_372730 3300042613 Bacteria 6189
126 Ga0466728_450661 3300042620 Unclassified 7822
127 Ga0466701_102020 3300042598 Bacteria 4481
128 Ga0466717_113072 3300042604 Bacteria 2226
129 Ga0466719_029723 3300042606 Bacteria 13054
130 Ga0466693_289132 3300042592 Bacteria 2591
131 Ga0466694_357625 3300042594 Bacteria 1500
132 Ga0123357_10068273 3300009784 Bacteria 4731
133 Ga0123356_10169799 3300010049 Bacteria 2190
134 Ga0123353_10498364 3300010167 Bacteria 1775
135 2227571863 2225789004 Bacteria 13781
136 JGI24702J35022_10056318 3300002462 Bacteria 2097
137 JGI24696J40584_12961687 3300002834 Bacteria 36323
138 Ga0123357_10001720 3300009784 Bacteria 23612
139 Ga0466724_31500 3300042649 Bacteria 3539
140 Ga0466708_060683 3300042652 Bacteria 49198
141 Ga0466727_093739 3300042655 Bacteria 17800
142 Ga0466705_256370 3300042612 Bacteria 21200
143 Ga0466705_437923 3300042612 Bacteria 14795
144 Ga0466711_373559 3300042615 Bacteria 1794
145 Ga0466715_087695 3300042616 Bacteria 3523
146 Ga0466728_138171 3300042620 Bacteria 48750
147 Ga0466701_078917 3300042598 Bacteria 7783
148 Ga0466716_429462 3300042605 Bacteria 7173
149 Ga0466719_330840 3300042606 Bacteria 4338
150 Ga0466733_187358 3300042659 Bacteria 6340
151 Ga0466691_048684 3300042593 Bacteria 4911
152 Ga0466691_081603 3300042593 Bacteria 26376
153 Ga0123357_10336757 3300009784 Bacteria 1465
154 Ga0123353_10145847 3300010167 Bacteria 3784
155 Ga0123353_10307424 3300010167 Bacteria 2415
156 JGI24702J35022_10006606 3300002462 Bacteria 6697
157 JGI24702J35022_10006949 3300002462 Unclassified 6508
158 Ga0466735_089686 3300042624 Bacteria 11865
159 Ga0466735_187415 3300042624 Bacteria 1595
160 Ga0466709_284062 3300042648 Bacteria 5408
161 Ga0466724_41023 3300042649 Bacteria 2640
162 Ga0466708_037354 3300042652 Bacteria 3112
163 Ga0466711_365823 3300042615 Bacteria 13020
164 Ga0466711_384618 3300042615 Bacteria 22548
165 Ga0466726_253610 3300042619 Bacteria 1445

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_187415 Ga0466735_187415_33_1175 380
2 3300042636 Ga0466703_135729 Ga0466703_135729_9861_11009 382
3 3300042592 Ga0466693_289132 Ga0466693_289132_1358_2545 395
4 3300042598 Ga0466701_095924 Ga0466701_095924_46_1233 395
5 3300042635 Ga0466702_009416 Ga0466702_009416_41_1234 397
6 3300002462 JGI24702J35022_10042718 JGI24702J35022_100427182 398
7 3300010049 Ga0123356_10399586 Ga0123356_103995862 401
8 3300042609 Ga0466722_125521 Ga0466722_125521_14576_15868 412
9 3300042624 Ga0466735_169084 Ga0466735_169084_511_1812 414
10 3300010167 Ga0123353_10008324 Ga0123353_1000832412 415
11 3300042605 Ga0466716_429462 Ga0466716_429462_2162_3460 417
12 3300042601 Ga0466707_418710 Ga0466707_418710_682_1986 418
13 3300042606 Ga0466719_029723 Ga0466719_029723_7041_8348 419
14 3300042606 Ga0466719_330840 Ga0466719_330840_758_2065 419
15 3300042615 Ga0466711_384618 Ga0466711_384618_5815_7122 419
16 3300042621 Ga0466729_268864 Ga0466729_268864_10054_11367 420
17 3300042635 Ga0466702_345415 Ga0466702_345415_906_2228 420
18 3300005083 Ga0068305_10057746 Ga0068305_100577467 421
19 3300042616 Ga0466715_087695 Ga0466715_087695_1070_2338 422
20 3300002834 JGI24696J40584_12961651 JGI24696J40584_1296165114 425
21 3300042601 Ga0466707_063453 Ga0466707_063453_3186_4556 425
22 3300042602 Ga0466713_038812 Ga0466713_038812_3746_5059 425
23 3300042619 Ga0466726_172879 Ga0466726_172879_3364_4671 425
24 3300042620 Ga0466728_278714 Ga0466728_278714_2849_4156 425
25 3300010167 Ga0123353_10000594 Ga0123353_1000059411 426
26 3300042596 Ga0466696_165406 Ga0466696_165406_2824_4155 426
27 3300042609 Ga0466722_240676 Ga0466722_240676_1613_2914 427
28 3300042649 Ga0466724_41023 Ga0466724_41023_1291_2574 427
29 3300042593 Ga0466691_081603 Ga0466691_081603_13062_14348 428
30 3300042643 Ga0466704_252042 Ga0466704_252042_2672_3958 428
31 3300042590 Ga0466690_015023 Ga0466690_015023_1997_3286 429
32 3300042590 Ga0466690_126381 Ga0466690_126381_7565_8854 429
33 3300042599 Ga0466706_017077 Ga0466706_017077_4850_6172 429
34 3300042604 Ga0466717_113072 Ga0466717_113072_144_1433 429
35 3300042609 Ga0466722_021911 Ga0466722_021911_39296_40585 429
36 3300042593 Ga0466691_028335 Ga0466691_028335_14666_15985 430
37 3300042609 Ga0466722_012804 Ga0466722_012804_22312_23604 430
38 3300042619 Ga0466726_253610 Ga0466726_253610_86_1378 430
39 3300038395 Ga0415639_077064 Ga0415639_077064_921_2216 431
40 3300042604 Ga0466717_270688 Ga0466717_270688_62_1378 431
41 3300042624 Ga0466735_089686 Ga0466735_089686_7827_9122 431
42 3300042636 Ga0466703_013908 Ga0466703_013908_5162_6457 431
43 3300002834 JGI24696J40584_12961687 JGI24696J40584_1296168728 432
44 3300010882 Ga0123354_10001016 Ga0123354_100010168 432
45 3300042596 Ga0466696_340248 Ga0466696_340248_1620_2948 432
46 3300042598 Ga0466701_031057 Ga0466701_031057_14007_15305 432
47 3300042598 Ga0466701_078917 Ga0466701_078917_4322_5620 432
48 3300042602 Ga0466713_017736 Ga0466713_017736_9151_10449 432
49 3300042604 Ga0466717_274538 Ga0466717_274538_94_1446 432
50 3300042609 Ga0466722_139334 Ga0466722_139334_1052_2350 432
51 3300042611 Ga0466697_167564 Ga0466697_167564_5174_6472 432
52 3300042612 Ga0466705_437923 Ga0466705_437923_4037_5335 432
53 3300042615 Ga0466711_272661 Ga0466711_272661_2480_3778 432
54 3300042615 Ga0466711_365823 Ga0466711_365823_4204_5502 432
55 3300042616 Ga0466715_042761 Ga0466715_042761_29208_30506 432
56 3300042616 Ga0466715_388028 Ga0466715_388028_55_1353 432
57 3300042616 Ga0466715_503781 Ga0466715_503781_18908_20206 432
58 3300042618 Ga0466723_010958 Ga0466723_010958_677_1975 432
59 3300042618 Ga0466723_335450 Ga0466723_335450_5619_6917 432
60 3300042643 Ga0466704_002372 Ga0466704_002372_22121_23419 432
61 3300042648 Ga0466709_273462 Ga0466709_273462_1291_2589 432
62 3300042649 Ga0466724_31500 Ga0466724_31500_1896_3194 432
63 3300042655 Ga0466727_051328 Ga0466727_051328_2774_4072 432
64 3300042656 Ga0466732_232142 Ga0466732_232142_3508_4806 432
65 3300000062 IMNBL1DRAFT_c0001686 IMNBL1DRAFT_000168616 433
66 3300000062 IMNBL1DRAFT_c0003394 IMNBL1DRAFT_00033949 433
67 3300000062 IMNBL1DRAFT_c0006837 IMNBL1DRAFT_00068375 433
68 3300002462 JGI24702J35022_10006949 JGI24702J35022_100069493 433
69 3300002462 JGI24702J35022_10056318 JGI24702J35022_100563181 433
70 3300009784 Ga0123357_10000257 Ga0123357_1000025743 433
71 3300009784 Ga0123357_10001720 Ga0123357_1000172010 433
72 3300009784 Ga0123357_10068273 Ga0123357_100682732 433
73 3300009784 Ga0123357_10336757 Ga0123357_103367571 433
74 3300010049 Ga0123356_10038011 Ga0123356_100380112 433
75 3300010049 Ga0123356_10169799 Ga0123356_101697992 433
76 3300010167 Ga0123353_10649737 Ga0123353_106497372 433
77 3300010882 Ga0123354_10083678 Ga0123354_100836784 433
78 3300010882 Ga0123354_10172874 Ga0123354_101728742 433
79 3300042550 Ga0466656_120950 Ga0466656_120950_8242_9543 433
80 3300042592 Ga0466693_081870 Ga0466693_081870_1473_2774 433
81 3300042602 Ga0466713_086346 Ga0466713_086346_8873_10174 433
82 3300042605 Ga0466716_257662 Ga0466716_257662_15383_16684 433
83 3300042612 Ga0466705_191068 Ga0466705_191068_3920_5221 433
84 3300042619 Ga0466726_048716 Ga0466726_048716_1375_2676 433
85 3300042620 Ga0466728_450661 Ga0466728_450661_2255_3556 433
86 3300042636 Ga0466703_399369 Ga0466703_399369_20527_21828 433
87 3300042643 Ga0466704_163818 Ga0466704_163818_1171_2472 433
88 iso_pr_bacteria 2820744581 2820745191 433
89 iso_pr_bacteria 2820797595 2820798740 433
90 3300010167 Ga0123353_10307424 Ga0123353_103074242 434
91 3300010167 Ga0123353_10498364 Ga0123353_104983642 434
92 3300010882 Ga0123354_10168668 Ga0123354_101686682 434
93 3300010882 Ga0123354_10213450 Ga0123354_102134501 434
94 3300042592 Ga0466693_344935 Ga0466693_344935_72_1376 434
95 3300042594 Ga0466694_357625 Ga0466694_357625_143_1447 434
96 3300042609 Ga0466722_006441 Ga0466722_006441_2347_3651 434
97 3300042613 Ga0466710_372730 Ga0466710_372730_199_1503 434
98 3300042622 Ga0466731_358898 Ga0466731_358898_7706_9010 434
99 3300042636 Ga0466703_021000 Ga0466703_021000_4788_6092 434
100 3300042643 Ga0466704_374722 Ga0466704_374722_11204_12508 434
101 3300042648 Ga0466709_159378 Ga0466709_159378_3316_4620 434
102 3300042652 Ga0466708_060683 Ga0466708_060683_32643_33947 434
103 3300042659 Ga0466733_055799 Ga0466733_055799_44692_45996 434
104 3300002504 JGI24705J35276_12237354 JGI24705J35276_122373548 435
105 3300010167 Ga0123353_10104475 Ga0123353_101044753 435
106 3300010167 Ga0123353_10145847 Ga0123353_101458473 435
107 3300042590 Ga0466690_048418 Ga0466690_048418_1837_3144 435
108 3300042590 Ga0466690_313164 Ga0466690_313164_283_1590 435
109 3300042596 Ga0466696_305108 Ga0466696_305108_3918_5225 435
110 3300042606 Ga0466719_160806 Ga0466719_160806_4246_5553 435
111 3300042606 Ga0466719_378540 Ga0466719_378540_827_2134 435
112 3300042612 Ga0466705_105693 Ga0466705_105693_14031_15338 435
113 3300042615 Ga0466711_213686 Ga0466711_213686_697_2004 435
114 3300042615 Ga0466711_373559 Ga0466711_373559_361_1668 435
115 3300042619 Ga0466726_165838 Ga0466726_165838_3893_5200 435
116 3300042619 Ga0466726_312321 Ga0466726_312321_212_1519 435
117 3300042655 Ga0466727_093739 Ga0466727_093739_9190_10497 435
118 3300042655 Ga0466727_172844 Ga0466727_172844_1562_2869 435
119 3300002834 JGI24696J40584_12960642 JGI24696J40584_129606424 436
120 3300010049 Ga0123356_10048427 Ga0123356_100484273 436
121 3300010167 Ga0123353_10001069 Ga0123353_1000106922 436
122 3300042616 Ga0466715_125107 Ga0466715_125107_11798_13108 436
123 3300042659 Ga0466733_138584 Ga0466733_138584_3004_4314 436
124 3300042601 Ga0466707_376420 Ga0466707_376420_19887_21200 437
125 3300042610 Ga0466698_328155 Ga0466698_328155_186_1499 437
126 3300042616 Ga0466715_194603 Ga0466715_194603_3496_4809 437
127 3300042623 Ga0466734_160465 Ga0466734_160465_74_1498 437
128 3300042652 Ga0466708_130167 Ga0466708_130167_47459_48772 437
129 iso_pr_bacteria 2820776227 2820777159 437
130 3300002462 JGI24702J35022_10000054 JGI24702J35022_1000005411 438
131 3300002462 JGI24702J35022_10006606 JGI24702J35022_100066063 438
132 3300042590 Ga0466690_159618 Ga0466690_159618_2715_4031 438
133 3300042598 Ga0466701_102020 Ga0466701_102020_1343_2659 438
134 3300042648 Ga0466709_284062 Ga0466709_284062_3256_4572 438
135 3300042652 Ga0466708_066817 Ga0466708_066817_2898_4214 438
136 3300042659 Ga0466733_187358 Ga0466733_187358_1456_2772 438
137 3300042659 Ga0466733_212465 Ga0466733_212465_1829_3145 438
138 3300042590 Ga0466690_087674 Ga0466690_087674_1975_3294 439
139 3300042591 Ga0466692_013440 Ga0466692_013440_2208_3527 439
140 3300042596 Ga0466696_091816 Ga0466696_091816_3991_5310 439
141 3300042596 Ga0466696_120177 Ga0466696_120177_2958_4277 439
142 3300042620 Ga0466728_138171 Ga0466728_138171_17791_19110 439
143 3300042648 Ga0466709_248020 Ga0466709_248020_370_1689 439
144 3300002462 JGI24702J35022_10007616 JGI24702J35022_100076163 440
145 3300002462 JGI24702J35022_10016164 JGI24702J35022_100161642 440
146 3300002462 JGI24702J35022_10024361 JGI24702J35022_100243613 440
147 3300042593 Ga0466691_048684 Ga0466691_048684_1596_2918 440
148 3300042602 Ga0466713_117267 Ga0466713_117267_24550_25872 440
149 3300042605 Ga0466716_347766 Ga0466716_347766_3255_4577 440
150 3300042616 Ga0466715_015212 Ga0466715_015212_4549_5871 440
151 3300042618 Ga0466723_277765 Ga0466723_277765_38071_39393 440
152 3300042618 Ga0466723_320199 Ga0466723_320199_3189_4511 440
153 3300042612 Ga0466705_267691 Ga0466705_267691_3661_4986 441
154 3300042643 Ga0466704_021495 Ga0466704_021495_9624_10949 441
155 3300042643 Ga0466704_024801 Ga0466704_024801_6283_7608 441
156 3300042591 Ga0466692_046708 Ga0466692_046708_2904_4232 442
157 3300042614 Ga0466712_298084 Ga0466712_298084_2297_3625 442
158 3300042652 Ga0466708_037354 Ga0466708_037354_1401_2729 442
159 3300042582 Ga0466657_389727 Ga0466657_389727_180_1514 444
160 3300042619 Ga0466726_089813 Ga0466726_089813_4143_5477 444
161 2225789004 2227571863 2228117622 445
162 3300042591 Ga0466692_001428 Ga0466692_001428_144_1481 445
163 3300042620 Ga0466728_289451 Ga0466728_289451_1352_2689 445
164 3300042617 Ga0466718_069150 Ga0466718_069150_62_1405 447
165 3300042624 Ga0466735_181813 Ga0466735_181813_233_1579 448
166 3300042612 Ga0466705_256370 Ga0466705_256370_8640_10013 451
167 iso_pr_bacteria 2820751898 2820753207 451
168 3300042601 Ga0466707_150969 Ga0466707_150969_10178_11539 453
169 3300042615 Ga0466711_148907 Ga0466711_148907_1673_3061 462

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00501 AMP-binding AMP-binding enzyme 73 288 0.77

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4rvn-assembly1.cif.gz_B Crystal structure of a Putative Acyl-CoA ligase (BT_0428) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution 0.854 5 428
4rvo-assembly1.cif.gz_B Crystal structure of a Putative Acyl-CoA ligase (BT_0428) from Bacteroides thetaiotaomicron VPI-5482 at 2.41 A resolution 0.853 5 428
2y27-assembly1.cif.gz_A crystal structure of PaaK1 in complex with ATP from Burkholderia cenocepacia 0.853 3 431
4r1m-assembly1.cif.gz_B Crystal structure of a Putative Acyl-CoA ligase (BT_0428) from Bacteroides thetaiotaomicron VPI-5482 at 2.48 A resolution 0.852 5 428
4r1l-assembly3.cif.gz_B Crystal structure of a Putative Acyl-CoA ligase (BT_0428) from Bacteroides thetaiotaomicron VPI-5482 at 2.42 A resolution 0.849 5 428
IDDescriptionScoreStartEndSuperfamily
2y4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9226 1 329 3.40.50.12780
3qovC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9202 1 329 3.40.50.12780
5gxdA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.8137 336 405 3.30.300.30
af_I1LI90_433_534_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.7963 331 406 3.30.300.30
af_Q9C7W4_6_145_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.7894 82 161 3.30.300.30
IDDescriptionScoreStartEndGO Terms
AF-A0A2N8NGU0-F1-model_v4 Uncharacterized/unreviewed 0.989 1 335
AF-A0A7V0P5Y3-F1-model_v4 Uncharacterized/unreviewed 0.9736 5 280
AF-A0A7W0ITC4-F1-model_v4 Uncharacterized/unreviewed 0.9726 5 326
AF-A0A1H1LSR9-F1-model_v4 Uncharacterized/unreviewed 0.9622 3 430

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.