Protein Family IF07490

Metagenome Isolate
125 Members
31 Samples
124 Scaffolds
159.86 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_118849|Ga0466711_118849_5887_6423
Length
178 aa
Sequence
MNGNFWKNYPESRYKFKDSTMEQYIQPFIDVCKNVFKEFIGAELTVGRPYFSSRETVDEWDISAVIGLTGEARGAVVISMKKDLALKLTDILAGGGHQDADEEVVDAIGEIINIIAGNAKQGLEAAFKLVISLPTIVQGKEHLIKWPNAQTRIICIPFTIFGNHVFNLSVAIQSVRGA

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 46.7%
Termitidae 26.7%
Rhinotermitidae 10.0%
Termopsidae 10.0%
Blaberidae 3.3%
Unclassified 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 2772190975 Treponema sp. RmG30 Isolate Blaberidae
28 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_348474 3300042601 Bacteria 2834
2 Ga0466722_092736 3300042609 Bacteria 2954
3 Ga0466711_180722 3300042615 Bacteria 11397
4 Ga0466711_476591 3300042615 Bacteria 12735
5 Ga0466715_565191 3300042616 Bacteria 9958
6 Ga0466705_315960 3300042612 Bacteria 5870
7 Ga0466703_210110 3300042636 Bacteria 87073
8 Ga0466704_202407 3300042643 Bacteria 10285
9 Ga0466709_238050 3300042648 Bacteria 17478
10 Ga0466709_291870 3300042648 Bacteria 15952
11 Ga0466708_081361 3300042652 Bacteria 4282
12 Ga0466727_138677 3300042655 Bacteria 2621
13 Ga0466716_403111 3300042605 Bacteria 4960
14 Ga0466711_114144 3300042615 Bacteria 4353
15 Ga0466723_079443 3300042618 Bacteria 2053
16 Ga0466723_116550 3300042618 Bacteria 1599
17 Ga0466726_130749 3300042619 Bacteria 7613
18 Ga0466728_401783 3300042620 Bacteria 5079
19 Ga0466705_157964 3300042612 Bacteria 4846
20 Ga0466708_009081 3300042652 Bacteria 16963
21 Ga0466708_171234 3300042652 Bacteria 2847
22 Ga0466690_401342 3300042590 Bacteria 4817
23 JGI24705J35276_12187374 3300002504 Bacteria 1429
24 Ga0466716_312165 3300042605 Bacteria 10896
25 Ga0466719_436180 3300042606 Bacteria 1932
26 Ga0466705_440001 3300042612 Bacteria 2429
27 Ga0466711_022411 3300042615 Bacteria 3339
28 Ga0466711_426874 3300042615 Bacteria 8760
29 Ga0466711_446733 3300042615 Bacteria 1704
30 Ga0466715_147164 3300042616 Bacteria 17560
31 Ga0466715_359951 3300042616 Bacteria 1613
32 Ga0466723_089347 3300042618 Unclassified 2598
33 Ga0466726_307780 3300042619 Bacteria 1264
34 Ga0466729_149991 3300042621 Unclassified 1617
35 Ga0466735_203493 3300042624 Bacteria 1460
36 Ga0466704_428099 3300042643 Bacteria 18779
37 Ga0466690_306705 3300042590 Unclassified 5446
38 Ga0466696_066416 3300042596 Bacteria 11514
39 Ga0123357_10016352 3300009784 Bacteria 9761
40 Ga0123353_10007636 3300010167 Bacteria 14654
41 Ga0466719_118850 3300042606 Bacteria 22662
42 Ga0466722_006906 3300042609 Bacteria 2483
43 Ga0466722_155562 3300042609 Bacteria 5009
44 Ga0466722_199806 3300042609 Bacteria 3568
45 Ga0466711_011556 3300042615 Bacteria 5493
46 Ga0466711_029362 3300042615 Bacteria 4754
47 Ga0466728_119528 3300042620 Bacteria 22681
48 Ga0466728_217286 3300042620 Bacteria 3743
49 Ga0466705_068047 3300042612 Bacteria 14016
50 Ga0466735_041731 3300042624 Bacteria 1149
51 Ga0466703_013993 3300042636 Bacteria 19436
52 Ga0466703_306142 3300042636 Bacteria 6822
53 Ga0466708_285068 3300042652 Unclassified 1487
54 Ga0466727_192667 3300042655 Bacteria 2997
55 Ga0466690_168322 3300042590 Bacteria 1761
56 Ga0123356_10965589 3300010049 Bacteria 1023
57 Ga0466722_062804 3300042609 Unclassified 1666
58 Ga0466722_066249 3300042609 Bacteria 12867
59 Ga0466711_504216 3300042615 Bacteria 2500
60 Ga0466715_368267 3300042616 Bacteria 4651
61 Ga0466715_604338 3300042616 Unclassified 2407
62 Ga0466723_024153 3300042618 Bacteria 15986
63 Ga0466726_162387 3300042619 Bacteria 1636
64 Ga0466728_022115 3300042620 Bacteria 13619
65 Ga0466728_170239 3300042620 Bacteria 7365
66 Ga0466705_280223 3300042612 Unclassified 4207
67 Ga0466703_177369 3300042636 Bacteria 10116
68 Ga0466704_449283 3300042643 Bacteria 2253
69 Ga0466709_329577 3300042648 Bacteria 2698
70 Ga0466727_064067 3300042655 Bacteria 6319
71 Ga0466727_302520 3300042655 Bacteria 11253
72 Ga0466696_465792 3300042596 Bacteria 1913
73 Ga0123356_13671700 3300010049 Bacteria 531
74 JGI24705J35276_12233291 3300002504 Bacteria 4760
75 Ga0466711_441473 3300042615 Bacteria 41991
76 Ga0466715_093829 3300042616 Bacteria 26315
77 Ga0466726_036523 3300042619 Bacteria 3159
78 Ga0466735_128786 3300042624 Bacteria 3084
79 Ga0466709_142334 3300042648 Bacteria 9021
80 Ga0466708_221151 3300042652 Bacteria 4775
81 Ga0466727_333764 3300042655 Bacteria 1684
82 Ga0466690_203975 3300042590 Bacteria 9971
83 Ga0466696_016261 3300042596 Bacteria 10401
84 Ga0466696_138427 3300042596 Bacteria 3297
85 JGI24698J34947_10004671 3300002449 Bacteria 7473
86 JGI24705J35276_11527571 3300002504 Bacteria 566
87 Ga0072941_1027684 3300005201 Unclassified 2415
88 Ga0466719_100250 3300042606 Bacteria 17752
89 Ga0466722_049511 3300042609 Bacteria 3777
90 Ga0466722_235375 3300042609 Bacteria 3392
91 Ga0466711_118849 3300042615 Bacteria 10253
92 Ga0466715_110855 3300042616 Unclassified 4428
93 Ga0466715_351505 3300042616 Unclassified 8356
94 Ga0466715_359064 3300042616 Bacteria 2884
95 Ga0466723_224336 3300042618 Bacteria 2268
96 Ga0466728_302063 3300042620 Bacteria 6252
97 Ga0466733_112084 3300042659 Bacteria 4043
98 Ga0466705_157947 3300042612 Bacteria 11546
99 Ga0466703_090140 3300042636 Bacteria 2495
100 Ga0466703_361847 3300042636 Bacteria 4373
101 Ga0466703_392601 3300042636 Bacteria 4310
102 Ga0466704_001289 3300042643 Unclassified 13319
103 Ga0466704_546677 3300042643 Unclassified 1344
104 Ga0466727_287400 3300042655 Bacteria 1398
105 Ga0466656_043817 3300042550 Bacteria 1028
106 Ga0466692_010008 3300042591 Bacteria 14489
107 Ga0466691_141615 3300042593 Bacteria 5860
108 Ga0466696_012727 3300042596 Bacteria 6837
109 JGI24702J35022_10003430 3300002462 Bacteria 9554
110 JGI24705J35276_12218254 3300002504 Bacteria 2135
111 Ga0072941_1054453 3300005201 Bacteria 5374
112 Ga0466716_082956 3300042605 Bacteria 2075
113 Ga0466722_146738 3300042609 Bacteria 4336
114 Ga0466722_156470 3300042609 Bacteria 3634
115 Ga0466715_165388 3300042616 Bacteria 1747
116 Ga0466726_447332 3300042619 Unclassified 1282
117 Ga0466728_163781 3300042620 Bacteria 2254
118 Ga0466735_184223 3300042624 Bacteria 1022
119 Ga0466704_024706 3300042643 Bacteria 5446
120 Ga0466704_031286 3300042643 Bacteria 5706
121 Ga0466704_121150 3300042643 Bacteria 3903
122 Ga0466704_575874 3300042643 Bacteria 1697
123 Ga0466708_035070 3300042652 Bacteria 8052
124 Ga0466708_073487 3300042652 Bacteria 7381

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10016352 Ga0123357_100163526 146
2 3300042652 Ga0466708_285068 Ga0466708_285068_236_697 147
3 3300010167 Ga0123353_10007636 Ga0123353_100076367 151
4 3300042643 Ga0466704_001289 Ga0466704_001289_6762_7220 152
5 3300042652 Ga0466708_009081 Ga0466708_009081_9232_9711 153
6 3300042590 Ga0466690_168322 Ga0466690_168322_1013_1480 155
7 3300042616 Ga0466715_147164 Ga0466715_147164_14834_15301 155
8 3300042620 Ga0466728_163781 Ga0466728_163781_1588_2058 156
9 3300002504 JGI24705J35276_12218254 JGI24705J35276_122182542 157
10 3300002504 JGI24705J35276_12233291 JGI24705J35276_122332913 157
11 3300042590 Ga0466690_306705 Ga0466690_306705_1312_1785 157
12 3300042596 Ga0466696_012727 Ga0466696_012727_2193_2666 157
13 3300042596 Ga0466696_138427 Ga0466696_138427_2026_2499 157
14 3300042606 Ga0466719_436180 Ga0466719_436180_724_1197 157
15 3300042609 Ga0466722_049511 Ga0466722_049511_2263_2736 157
16 3300042616 Ga0466715_093829 Ga0466715_093829_16533_17006 157
17 3300042616 Ga0466715_110855 Ga0466715_110855_1494_1967 157
18 3300042616 Ga0466715_165388 Ga0466715_165388_203_676 157
19 3300042620 Ga0466728_022115 Ga0466728_022115_8672_9145 157
20 3300042620 Ga0466728_119528 Ga0466728_119528_16060_16533 157
21 3300042648 Ga0466709_291870 Ga0466709_291870_4010_4483 157
22 3300042652 Ga0466708_073487 Ga0466708_073487_5667_6140 157
23 3300042659 Ga0466733_112084 Ga0466733_112084_231_704 157
24 3300005201 Ga0072941_1027684 Ga0072941_10276842 158
25 3300005201 Ga0072941_1054453 Ga0072941_10544531 158
26 3300042590 Ga0466690_203975 Ga0466690_203975_872_1348 158
27 3300042590 Ga0466690_401342 Ga0466690_401342_3840_4316 158
28 3300042593 Ga0466691_141615 Ga0466691_141615_2689_3165 158
29 3300042596 Ga0466696_016261 Ga0466696_016261_2796_3272 158
30 3300042596 Ga0466696_066416 Ga0466696_066416_2813_3289 158
31 3300042596 Ga0466696_465792 Ga0466696_465792_1246_1722 158
32 3300042601 Ga0466707_348474 Ga0466707_348474_373_849 158
33 3300042605 Ga0466716_312165 Ga0466716_312165_7207_7683 158
34 3300042605 Ga0466716_403111 Ga0466716_403111_4394_4870 158
35 3300042606 Ga0466719_100250 Ga0466719_100250_13569_14045 158
36 3300042606 Ga0466719_118850 Ga0466719_118850_7187_7663 158
37 3300042609 Ga0466722_006906 Ga0466722_006906_627_1103 158
38 3300042609 Ga0466722_199806 Ga0466722_199806_412_888 158
39 3300042612 Ga0466705_157947 Ga0466705_157947_7945_8421 158
40 3300042612 Ga0466705_157964 Ga0466705_157964_3887_4363 158
41 3300042612 Ga0466705_440001 Ga0466705_440001_672_1148 158
42 3300042615 Ga0466711_022411 Ga0466711_022411_277_753 158
43 3300042615 Ga0466711_029362 Ga0466711_029362_1862_2338 158
44 3300042615 Ga0466711_114144 Ga0466711_114144_3480_3956 158
45 3300042615 Ga0466711_180722 Ga0466711_180722_4988_5464 158
46 3300042615 Ga0466711_441473 Ga0466711_441473_5617_6093 158
47 3300042615 Ga0466711_446733 Ga0466711_446733_228_704 158
48 3300042615 Ga0466711_504216 Ga0466711_504216_1912_2388 158
49 3300042616 Ga0466715_351505 Ga0466715_351505_7096_7572 158
50 3300042616 Ga0466715_359951 Ga0466715_359951_545_1021 158
51 3300042616 Ga0466715_368267 Ga0466715_368267_2915_3391 158
52 3300042616 Ga0466715_565191 Ga0466715_565191_7362_7838 158
53 3300042616 Ga0466715_604338 Ga0466715_604338_1005_1481 158
54 3300042618 Ga0466723_024153 Ga0466723_024153_7271_7747 158
55 3300042618 Ga0466723_089347 Ga0466723_089347_1633_2109 158
56 3300042618 Ga0466723_224336 Ga0466723_224336_18_494 158
57 3300042619 Ga0466726_036523 Ga0466726_036523_1479_1955 158
58 3300042619 Ga0466726_130749 Ga0466726_130749_2466_2942 158
59 3300042619 Ga0466726_162387 Ga0466726_162387_485_961 158
60 3300042619 Ga0466726_447332 Ga0466726_447332_59_535 158
61 3300042620 Ga0466728_217286 Ga0466728_217286_749_1225 158
62 3300042620 Ga0466728_302063 Ga0466728_302063_4005_4481 158
63 3300042620 Ga0466728_401783 Ga0466728_401783_3724_4200 158
64 3300042624 Ga0466735_041731 Ga0466735_041731_508_984 158
65 3300042624 Ga0466735_184223 Ga0466735_184223_228_704 158
66 3300042624 Ga0466735_203493 Ga0466735_203493_921_1397 158
67 3300042636 Ga0466703_013993 Ga0466703_013993_10256_10732 158
68 3300042636 Ga0466703_177369 Ga0466703_177369_3383_3859 158
69 3300042636 Ga0466703_210110 Ga0466703_210110_52441_52917 158
70 3300042636 Ga0466703_306142 Ga0466703_306142_6323_6799 158
71 3300042636 Ga0466703_361847 Ga0466703_361847_915_1391 158
72 3300042636 Ga0466703_392601 Ga0466703_392601_2994_3470 158
73 3300042643 Ga0466704_024706 Ga0466704_024706_3497_3973 158
74 3300042643 Ga0466704_121150 Ga0466704_121150_2100_2576 158
75 3300042643 Ga0466704_202407 Ga0466704_202407_5863_6339 158
76 3300042643 Ga0466704_449283 Ga0466704_449283_1418_1894 158
77 3300042643 Ga0466704_575874 Ga0466704_575874_14_490 158
78 3300042648 Ga0466709_142334 Ga0466709_142334_4081_4557 158
79 3300042648 Ga0466709_238050 Ga0466709_238050_6181_6657 158
80 3300042648 Ga0466709_329577 Ga0466709_329577_517_993 158
81 3300042652 Ga0466708_081361 Ga0466708_081361_530_1006 158
82 3300042652 Ga0466708_171234 Ga0466708_171234_493_969 158
83 3300042652 Ga0466708_221151 Ga0466708_221151_634_1110 158
84 3300042655 Ga0466727_064067 Ga0466727_064067_4025_4501 158
85 3300042655 Ga0466727_138677 Ga0466727_138677_1389_1865 158
86 3300042655 Ga0466727_287400 Ga0466727_287400_86_562 158
87 3300042655 Ga0466727_333764 Ga0466727_333764_155_631 158
88 3300002462 JGI24702J35022_10003430 JGI24702J35022_1000343011 159
89 3300002504 JGI24705J35276_11527571 JGI24705J35276_115275711 159
90 3300002504 JGI24705J35276_12187374 JGI24705J35276_121873742 159
91 3300010049 Ga0123356_13671700 Ga0123356_136717001 159
92 3300042615 Ga0466711_426874 Ga0466711_426874_1518_1997 159
93 3300042615 Ga0466711_476591 Ga0466711_476591_2852_3331 159
94 3300042620 Ga0466728_170239 Ga0466728_170239_3196_3675 159
95 3300042652 Ga0466708_035070 Ga0466708_035070_2406_2885 159
96 3300042609 Ga0466722_062804 Ga0466722_062804_543_1025 160
97 3300042609 Ga0466722_066249 Ga0466722_066249_6653_7135 160
98 3300042609 Ga0466722_092736 Ga0466722_092736_1312_1794 160
99 3300042609 Ga0466722_146738 Ga0466722_146738_1670_2152 160
100 3300042609 Ga0466722_155562 Ga0466722_155562_3623_4105 160
101 3300042609 Ga0466722_156470 Ga0466722_156470_2238_2720 160
102 3300042609 Ga0466722_235375 Ga0466722_235375_2188_2670 160
103 3300042612 Ga0466705_280223 Ga0466705_280223_2625_3107 160
104 3300042615 Ga0466711_011556 Ga0466711_011556_383_865 160
105 3300042621 Ga0466729_149991 Ga0466729_149991_1107_1589 160
106 3300042643 Ga0466704_428099 Ga0466704_428099_14496_14978 160
107 3300042655 Ga0466727_302520 Ga0466727_302520_904_1386 160
108 3300042550 Ga0466656_043817 Ga0466656_043817_159_644 161
109 3300042616 Ga0466715_359064 Ga0466715_359064_536_1021 161
110 3300042619 Ga0466726_307780 Ga0466726_307780_496_981 161
111 3300042655 Ga0466727_192667 Ga0466727_192667_620_1105 161
112 3300042612 Ga0466705_315960 Ga0466705_315960_3942_4430 162
113 3300042643 Ga0466704_546677 Ga0466704_546677_259_747 162
114 3300010049 Ga0123356_10965589 Ga0123356_109655892 163
115 3300042624 Ga0466735_128786 Ga0466735_128786_392_883 163
116 3300002449 JGI24698J34947_10004671 JGI24698J34947_100046714 165
117 3300042591 Ga0466692_010008 Ga0466692_010008_1898_2398 166
118 3300042612 Ga0466705_068047 Ga0466705_068047_3322_3825 167
119 3300042618 Ga0466723_079443 Ga0466723_079443_1098_1613 171
120 3300042618 Ga0466723_116550 Ga0466723_116550_367_900 177
121 3300042643 Ga0466704_031286 Ga0466704_031286_2195_2728 177
122 3300042615 Ga0466711_118849 Ga0466711_118849_5887_6423 178
123 3300042636 Ga0466703_090140 Ga0466703_090140_1288_1869 193
124 iso_pr_bacteria 2772190975 2773723986 200
125 3300042605 Ga0466716_082956 Ga0466716_082956_991_1878 220

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13690 CheX Chemotaxis phosphatase CheX 62 158 0.9

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3hm4-assembly1.cif.gz_B CRYSTAL STRUCTURE OF A CHEMOTAXIS PROTEIN CHEX (DDE_0281) FROM DESULFOVIBRIO DESULFURICANS SUBSP. AT 1.30 A RESOLUTION 0.897 23 173
3iic-assembly1.cif.gz_B Crystal structure of CheC-like superfamily protein (YP_001095400.1) from Shewanella SP. PV-4 at 2.13 A resolution 0.896 24 174
1squ-assembly1.cif.gz_A Structural Genomics, Crystal structure of the CheX protein from Thermotoga maritima 0.895 25 173
6vpw-assembly1.cif.gz_B 1.90 Angstrom Resolution Crystal Structure Chemotaxis protein CheX from Vibrio vulnificus 0.895 23 173
3h4y-assembly1.cif.gz_A-2 Crystal structure of putative chemotaxis protein (YP_009526.1) from DESULFOVIBRIO VULGARIS HILDENBOROUGH at 1.55 A resolution 0.894 23 173
IDDescriptionScoreStartEndSuperfamily
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8807 19 173 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.857 23 173 3.40.1550.10
3h2dA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8357 22 173 3.40.1550.10
3hzhB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8182 24 174 3.40.1550.10
4gc8C00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.7282 18 171 3.40.1550.10
IDDescriptionScoreStartEndGO Terms
AF-A0A5C6FBC1-F1-model_v4 Uncharacterized/unreviewed 0.9553 21 176 GO:0016787
GO:0006935

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.