Protein Family IF07462

Metagenome Isolate
118 Members
33 Samples
116 Scaffolds
127.77 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_055069|Ga0466711_055069_526_966
Length
146 aa
Sequence
MSVSYVIVQRGNPGNPEAPKKFYAQAKSRGELTFRKLSKEIAEGSTTVSDTDVLAVLNDLTKVLKRHLDNGEIVRFGDFGTFQVGISSEGAETEAKFHSSLIKNPKVVFRPGIDLKEMLATLKYEKVFPVVPTTNPKADELLKKDK

📊 Sample Types

Isolate 1.7%
Metagenome 98.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.6%
Termitidae 25.0%
Unclassified 9.4%
Termopsidae 9.4%
Passalidae 6.2%
Rhinotermitidae 6.2%
Blattidae 3.1%

🌳 Taxonomy

Archaea 0
Bacteria 101
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
4 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
33 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 2227571863 2225789004 Bacteria 13781
2 Ga0068302_10054757 3300005071 Bacteria 5505
3 Ga0072941_1333228 3300005201 Bacteria 1775
4 Ga0466707_090859 3300042601 Bacteria 7347
5 Ga0466705_051098 3300042612 Bacteria 9320
6 Ga0466703_105658 3300042636 Unclassified 14860
7 Ga0466703_106708 3300042636 Bacteria 11343
8 Ga0466703_197933 3300042636 Bacteria 2388
9 Ga0466703_260797 3300042636 Bacteria 4494
10 Ga0466709_129172 3300042648 Bacteria 9385
11 Ga0466709_314545 3300042648 Bacteria 211401
12 Ga0466708_081730 3300042652 Bacteria 1236
13 Ga0466708_119530 3300042652 Unclassified 1864
14 Ga0466725_405811 3300042654 Bacteria 1057
15 Ga0466715_345237 3300042616 Unclassified 4768
16 Ga0466715_623390 3300042616 Unclassified 2026
17 Ga0466690_409593 3300042590 Bacteria 1293
18 IMNBL1DRAFT_c0092744 3300000062 Bacteria 825
19 Ga0466707_149665 3300042601 Bacteria 15393
20 Ga0466716_195956 3300042605 Unclassified 3049
21 Ga0466705_234984 3300042612 Bacteria 2039
22 Ga0466708_265369 3300042652 Bacteria 10590
23 Ga0466708_271898 3300042652 Unclassified 4867
24 Ga0466708_403438 3300042652 Bacteria 4480
25 Ga0466711_025529 3300042615 Bacteria 4969
26 Ga0466711_055069 3300042615 Bacteria 1183
27 Ga0466711_249393 3300042615 Bacteria 3810
28 Ga0466728_474307 3300042620 Bacteria 3700
29 2227538535 2225789004 Bacteria 15745
30 IMNBL1DRAFT_c0009097 3300000062 Bacteria 4963
31 JGI24696J40584_12934929 3300002834 Unclassified 1549
32 Ga0466707_175216 3300042601 Unclassified 5106
33 Ga0466713_035223 3300042602 Bacteria 4485
34 Ga0466713_127438 3300042602 Bacteria 6165
35 Ga0466719_273722 3300042606 Bacteria 4777
36 Ga0466722_213529 3300042609 Bacteria 2327
37 Ga0466704_521785 3300042643 Bacteria 2980
38 Ga0466708_357683 3300042652 Bacteria 12095
39 Ga0466708_381469 3300042652 Bacteria 6607
40 Ga0466732_329036 3300042656 Bacteria 1506
41 Ga0466733_109699 3300042659 Bacteria 1766
42 Ga0466690_118212 3300042590 Bacteria 7212
43 Ga0466690_278512 3300042590 Bacteria 2385
44 Ga0466696_240292 3300042596 Bacteria 3054
45 Ga0466717_158878 3300042604 Bacteria 1748
46 Ga0466722_239488 3300042609 Bacteria 1535
47 Ga0466703_138591 3300042636 Bacteria 12628
48 Ga0466704_313169 3300042643 Bacteria 5281
49 Ga0466704_475673 3300042643 Bacteria 25542
50 Ga0466732_211184 3300042656 Bacteria 1631
51 Ga0466733_066441 3300042659 Unclassified 1814
52 Ga0466733_162458 3300042659 Bacteria 7480
53 Ga0466711_370994 3300042615 Bacteria 1601
54 Ga0466715_025302 3300042616 Bacteria 5206
55 Ga0466715_068298 3300042616 Unclassified 4189
56 Ga0466715_084575 3300042616 Bacteria 5539
57 Ga0466656_222238 3300042550 Bacteria 2020
58 IMNBL1DRAFT_c0050693 3300000062 Bacteria 1313
59 JGI24702J35022_10000324 3300002462 Bacteria 28237
60 Ga0068302_10008227 3300005071 Bacteria 3044
61 Ga0466716_149971 3300042605 Bacteria 2805
62 Ga0466727_021420 3300042655 Bacteria 3125
63 Ga0466711_259143 3300042615 Bacteria 5045
64 Ga0466723_247958 3300042618 Bacteria 1151
65 Ga0466690_059873 3300042590 Bacteria 1701
66 Ga0466690_267807 3300042590 Bacteria 3178
67 Ga0466696_044008 3300042596 Bacteria 4906
68 Ga0466696_048401 3300042596 Unclassified 4789
69 Ga0466696_107781 3300042596 Bacteria 2588
70 Ga0123356_11615798 3300010049 Bacteria 802
71 2227165831 2225789004 Bacteria 1539
72 IMNBL1DRAFT_c0000933 3300000062 Bacteria 22594
73 IMNBL1DRAFT_c0001288 3300000062 Bacteria 18888
74 JGI24702J35022_10339671 3300002462 Bacteria 895
75 Ga0466707_105454 3300042601 Bacteria 2907
76 Ga0466703_114207 3300042636 Bacteria 11466
77 Ga0466709_406939 3300042648 Bacteria 144693
78 Ga0466708_097064 3300042652 Unclassified 5348
79 Ga0466733_055155 3300042659 Bacteria 3699
80 Ga0466711_158974 3300042615 Unclassified 6366
81 Ga0466715_265229 3300042616 Bacteria 4530
82 Ga0466715_285360 3300042616 Bacteria 7998
83 Ga0466723_088373 3300042618 Bacteria 1635
84 Ga0466713_027405 3300042602 Bacteria 1601
85 Ga0466719_418549 3300042606 Bacteria 1164
86 Ga0466705_071601 3300042612 Bacteria 2089
87 Ga0466703_180988 3300042636 Bacteria 4567
88 Ga0466703_407109 3300042636 Bacteria 1071
89 Ga0466704_113504 3300042643 Bacteria 13015
90 Ga0466704_162306 3300042643 Bacteria 7066
91 Ga0466704_204890 3300042643 Bacteria 5024
92 Ga0466704_613721 3300042643 Bacteria 3372
93 Ga0466708_316176 3300042652 Unclassified 1176
94 Ga0466733_018031 3300042659 Bacteria 8919
95 Ga0466733_030390 3300042659 Bacteria 8372
96 Ga0466733_139821 3300042659 Bacteria 12988
97 Ga0466711_131018 3300042615 Bacteria 37915
98 Ga0466715_310361 3300042616 Bacteria 7425
99 Ga0466723_024120 3300042618 Bacteria 1722
100 Ga0466723_276654 3300042618 Bacteria 1920
101 Ga0466728_101703 3300042620 Bacteria 5508
102 Ga0466690_132435 3300042590 Bacteria 16004
103 Ga0466690_269685 3300042590 Bacteria 7441
104 Ga0466696_292894 3300042596 Unclassified 1669
105 IMNBL1DRAFT_c0094036 3300000062 Unclassified 816
106 Ga0466707_123089 3300042601 Bacteria 1324
107 Ga0466707_191226 3300042601 Bacteria 1054
108 Ga0466717_267201 3300042604 Bacteria 1910
109 Ga0466703_177766 3300042636 Bacteria 2360
110 Ga0466733_210672 3300042659 Bacteria 1783
111 Ga0466711_171608 3300042615 Bacteria 5779
112 Ga0466715_251195 3300042616 Unclassified 2958
113 Ga0466723_230674 3300042618 Bacteria 2503
114 Ga0466726_144476 3300042619 Bacteria 21004
115 Ga0466692_078489 3300042591 Bacteria 4311
116 Ga0466692_111305 3300042591 Bacteria 1159

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_247958 Ga0466723_247958_568_918 116
2 3300042612 Ga0466705_234984 Ga0466705_234984_1054_1425 123
3 3300042643 Ga0466704_521785 Ga0466704_521785_341_712 123
4 3300042652 Ga0466708_119530 Ga0466708_119530_1483_1854 123
5 3300042643 Ga0466704_613721 Ga0466704_613721_2769_3146 125
6 3300042590 Ga0466690_267807 Ga0466690_267807_1993_2373 126
7 3300042591 Ga0466692_078489 Ga0466692_078489_3579_3959 126
8 3300042591 Ga0466692_111305 Ga0466692_111305_461_841 126
9 3300042596 Ga0466696_107781 Ga0466696_107781_578_958 126
10 3300042601 Ga0466707_090859 Ga0466707_090859_5299_5679 126
11 3300042601 Ga0466707_105454 Ga0466707_105454_2279_2659 126
12 3300042601 Ga0466707_175216 Ga0466707_175216_1313_1693 126
13 3300042602 Ga0466713_027405 Ga0466713_027405_852_1232 126
14 3300042602 Ga0466713_035223 Ga0466713_035223_63_443 126
15 3300042602 Ga0466713_127438 Ga0466713_127438_2217_2597 126
16 3300042604 Ga0466717_158878 Ga0466717_158878_419_799 126
17 3300042605 Ga0466716_195956 Ga0466716_195956_173_553 126
18 3300042606 Ga0466719_418549 Ga0466719_418549_311_691 126
19 3300042609 Ga0466722_239488 Ga0466722_239488_488_868 126
20 3300042615 Ga0466711_025529 Ga0466711_025529_3878_4258 126
21 3300042615 Ga0466711_249393 Ga0466711_249393_2070_2450 126
22 3300042616 Ga0466715_068298 Ga0466715_068298_358_738 126
23 3300042616 Ga0466715_084575 Ga0466715_084575_4548_4928 126
24 3300042616 Ga0466715_251195 Ga0466715_251195_2534_2914 126
25 3300042616 Ga0466715_265229 Ga0466715_265229_2785_3165 126
26 3300042616 Ga0466715_310361 Ga0466715_310361_5750_6130 126
27 3300042616 Ga0466715_345237 Ga0466715_345237_3967_4347 126
28 3300042616 Ga0466715_623390 Ga0466715_623390_98_478 126
29 3300042618 Ga0466723_088373 Ga0466723_088373_544_924 126
30 3300042618 Ga0466723_230674 Ga0466723_230674_13_393 126
31 3300042620 Ga0466728_101703 Ga0466728_101703_4092_4472 126
32 3300042636 Ga0466703_138591 Ga0466703_138591_3673_4053 126
33 3300042643 Ga0466704_475673 Ga0466704_475673_3808_4188 126
34 3300042652 Ga0466708_081730 Ga0466708_081730_637_1017 126
35 3300042652 Ga0466708_097064 Ga0466708_097064_283_663 126
36 3300042652 Ga0466708_271898 Ga0466708_271898_1636_2016 126
37 3300042652 Ga0466708_316176 Ga0466708_316176_539_919 126
38 3300042652 Ga0466708_403438 Ga0466708_403438_3465_3845 126
39 3300042656 Ga0466732_211184 Ga0466732_211184_1234_1614 126
40 3300042656 Ga0466732_329036 Ga0466732_329036_413_793 126
41 3300042659 Ga0466733_018031 Ga0466733_018031_3538_3918 126
42 3300005201 Ga0072941_1333228 Ga0072941_13332282 127
43 3300042601 Ga0466707_123089 Ga0466707_123089_750_1133 127
44 3300042601 Ga0466707_149665 Ga0466707_149665_6024_6407 127
45 3300042601 Ga0466707_191226 Ga0466707_191226_280_663 127
46 3300042609 Ga0466722_213529 Ga0466722_213529_355_738 127
47 3300042612 Ga0466705_051098 Ga0466705_051098_6252_6635 127
48 3300042615 Ga0466711_158974 Ga0466711_158974_1638_2021 127
49 3300042615 Ga0466711_370994 Ga0466711_370994_1004_1387 127
50 3300042636 Ga0466703_105658 Ga0466703_105658_1452_1835 127
51 3300042636 Ga0466703_106708 Ga0466703_106708_10827_11210 127
52 3300042636 Ga0466703_177766 Ga0466703_177766_1083_1466 127
53 3300042636 Ga0466703_197933 Ga0466703_197933_321_704 127
54 3300042643 Ga0466704_113504 Ga0466704_113504_221_604 127
55 3300042643 Ga0466704_313169 Ga0466704_313169_3771_4154 127
56 3300042652 Ga0466708_265369 Ga0466708_265369_2727_3110 127
57 3300042654 Ga0466725_405811 Ga0466725_405811_550_933 127
58 3300042659 Ga0466733_030390 Ga0466733_030390_6583_6966 127
59 3300042659 Ga0466733_055155 Ga0466733_055155_655_1038 127
60 3300042659 Ga0466733_066441 Ga0466733_066441_428_811 127
61 3300042659 Ga0466733_109699 Ga0466733_109699_910_1293 127
62 3300042659 Ga0466733_139821 Ga0466733_139821_4650_5033 127
63 3300042659 Ga0466733_162458 Ga0466733_162458_3100_3483 127
64 3300042659 Ga0466733_210672 Ga0466733_210672_297_680 127
65 2225789004 2227165831 2227578110 128
66 2225789004 2227538535 2228058277 128
67 3300002834 JGI24696J40584_12934929 JGI24696J40584_129349291 128
68 3300042550 Ga0466656_222238 Ga0466656_222238_1374_1760 128
69 3300042590 Ga0466690_118212 Ga0466690_118212_1981_2367 128
70 3300042590 Ga0466690_269685 Ga0466690_269685_6496_6882 128
71 3300042590 Ga0466690_278512 Ga0466690_278512_1363_1749 128
72 3300042596 Ga0466696_044008 Ga0466696_044008_3441_3827 128
73 3300042596 Ga0466696_048401 Ga0466696_048401_393_779 128
74 3300042596 Ga0466696_240292 Ga0466696_240292_2344_2730 128
75 3300042596 Ga0466696_292894 Ga0466696_292894_30_416 128
76 3300042605 Ga0466716_149971 Ga0466716_149971_1651_2037 128
77 3300042612 Ga0466705_071601 Ga0466705_071601_1121_1507 128
78 3300042615 Ga0466711_131018 Ga0466711_131018_23639_24025 128
79 3300042615 Ga0466711_171608 Ga0466711_171608_28_414 128
80 3300042615 Ga0466711_259143 Ga0466711_259143_4632_5018 128
81 3300042616 Ga0466715_025302 Ga0466715_025302_4596_4982 128
82 3300042616 Ga0466715_285360 Ga0466715_285360_5586_5972 128
83 3300042618 Ga0466723_024120 Ga0466723_024120_22_408 128
84 3300042618 Ga0466723_276654 Ga0466723_276654_958_1344 128
85 3300042619 Ga0466726_144476 Ga0466726_144476_513_899 128
86 3300042620 Ga0466728_474307 Ga0466728_474307_3201_3587 128
87 3300042636 Ga0466703_114207 Ga0466703_114207_777_1163 128
88 3300042636 Ga0466703_260797 Ga0466703_260797_3762_4148 128
89 3300042636 Ga0466703_407109 Ga0466703_407109_170_556 128
90 3300042643 Ga0466704_204890 Ga0466704_204890_4109_4495 128
91 3300042648 Ga0466709_129172 Ga0466709_129172_2537_2923 128
92 3300042648 Ga0466709_314545 Ga0466709_314545_150273_150659 128
93 3300042648 Ga0466709_406939 Ga0466709_406939_8831_9217 128
94 3300042652 Ga0466708_381469 Ga0466708_381469_5365_5751 128
95 3300042655 Ga0466727_021420 Ga0466727_021420_511_897 128
96 iso_pr_bacteria 2820737921 2820737934 128
97 3300000062 IMNBL1DRAFT_c0000933 IMNBL1DRAFT_00009334 129
98 3300000062 IMNBL1DRAFT_c0009097 IMNBL1DRAFT_00090972 129
99 3300000062 IMNBL1DRAFT_c0050693 IMNBL1DRAFT_00506932 129
100 3300000062 IMNBL1DRAFT_c0092744 IMNBL1DRAFT_00927442 129
101 3300002462 JGI24702J35022_10000324 JGI24702J35022_1000032413 129
102 3300005071 Ga0068302_10008227 Ga0068302_100082272 129
103 3300005071 Ga0068302_10054757 Ga0068302_100547576 129
104 3300010049 Ga0123356_11615798 Ga0123356_116157982 129
105 3300042590 Ga0466690_132435 Ga0466690_132435_4782_5171 129
106 3300042604 Ga0466717_267201 Ga0466717_267201_1266_1655 129
107 3300042643 Ga0466704_162306 Ga0466704_162306_691_1080 129
108 3300000062 IMNBL1DRAFT_c0001288 IMNBL1DRAFT_00012882 130
109 2225789004 2227571863 2228117630 131
110 3300002462 JGI24702J35022_10339671 JGI24702J35022_103396711 131
111 3300000062 IMNBL1DRAFT_c0094036 IMNBL1DRAFT_00940361 132
112 3300042590 Ga0466690_059873 Ga0466690_059873_698_1102 134
113 3300042606 Ga0466719_273722 Ga0466719_273722_1651_2055 134
114 3300042590 Ga0466690_409593 Ga0466690_409593_26_433 135
115 3300042636 Ga0466703_180988 Ga0466703_180988_562_969 135
116 iso_pr_bacteria 2940216256 2940218371 141
117 3300042615 Ga0466711_055069 Ga0466711_055069_526_966 146
118 3300042652 Ga0466708_357683 Ga0466708_357683_8427_8867 146

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18291 HU-HIG HU domain fused to wHTH, Ig, or Glycine-rich motif 1 126 0.96
PF00216 Bac_DNA_binding Bacterial DNA-binding protein 35 119 0.82

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
1riy-assembly1.cif.gz_A-2 HU mutant V42I from Thermotoga maritima 0.89 32 119
6o8q-assembly1.cif.gz_D HUaa 19bp SYM DNA pH 4.5 0.876 30 119
6oaj-assembly1.cif.gz_C HUaE34K 19bp SYM DNA 0.874 32 119
4p3v-assembly1.cif.gz_A-2 Crystal structure of the E. coli HU beta2 protein 0.872 32 119
4yex-assembly1.cif.gz_C HUaa-19bp 0.872 32 119
IDDescriptionScoreStartEndSuperfamily
4yexA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.818 32 119 4.10.520.10
6n2lA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8071 28 121 4.10.520.10
2np2B00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.7777 29 123 4.10.520.10
2ov7C01 Special;Helix non-globular;Arc Repressor Mutant, subunit A;50S ribosomal protein L1; Chain A, Domain 1 0.755 27 67 6.10.20.140
5fbmA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.7536 32 120 4.10.520.10
IDDescriptionScoreStartEndGO Terms
AF-A0A1I7F1Q3-F1-model_v4 Uncharacterized/unreviewed 0.974 1 128 GO:0003677

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.68 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.