Protein Family IF07449

Metagenome Isolate
172 Members
85 Samples
126 Scaffolds
441.72 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_015225|Ga0466711_015225_13447_14997
Length
504 aa
Sequence
MLFSNNSFAAFLLSGFEYEKTGEKMMKAKDSICRCADEAKRFVTDDCCLLFIIDKSRIIILTKFVIFGMIKRNSMNWQQLLSVKRFGMDFQRDYDRLVFSSPFRRLQNKTQVFPLPGSVFVHNRLTHSIEVSCVGRSLGMVVGRELRKKYPDSGADFEEISSIVAAGCLAHDLGNPPFGHSGEKAITSYFSEGKGKYLEKKVRQEGGRWEDFTNFEGNANSIRMLIHQFNGRRPGGFVMTYSMLASIVKYPYSALAANDKGKFGFFQAEENDFRKIADELGMACMQESPLRYARHPLVYLVEAADDICYKIMDIEDAHKLGLLSTEQTINLFMNFFPEERQMEMHRTMDRVNDINEQIAYLRSSVIGLLVGECTAVFLENEKPVLEGRFEDALVKHISPLPNKAHKEATDTSYKKIYKTKDVVDIELAGHRIIGFLLDTFITAIENPEAKYSELILSRVPEQFEKDAPTLYGRILAILDFVSGMTDVYALDLYRKITGMSLPTV

📊 Sample Types

Isolate 26.7%
Metagenome 73.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 40.0%
Kalotermitidae 16.5%
Termitidae 12.9%
Unclassified 11.8%
Rhinotermitidae 4.7%
Termopsidae 4.7%
Passalidae 3.5%
Hydrophilidae 2.4%
Hodotermitidae 1.2%
Culicidae 1.2%
Tenebrionidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 166
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
2 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
3 2923982719 Parabacteroides sp. 52 Isolate Blattidae
4 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
5 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
6 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
7 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
15 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
16 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
17 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
18 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
19 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
27 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
28 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
29 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
30 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
31 3004667792 Bacteroides sp. 519 Isolate Blattidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
38 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
39 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
43 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
44 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
47 2922326829 Bacteroides sp. 224 Isolate Blattidae
48 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
49 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
50 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
51 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
55 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
56 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
57 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
58 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
59 3004677695 Bacteroides sp. 214 Isolate Blattidae
60 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
61 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
62 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
63 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
64 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
65 2920168565 Paludibacter sp. 221 Isolate Blattidae
66 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
67 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
68 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
69 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
70 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
71 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
72 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
73 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
74 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
75 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
76 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
77 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
78 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
79 3004672520 Bacteroides sp. 51 Isolate Blattidae
80 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
81 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
82 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
83 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
84 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
85 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_053829 3300042659 Bacteria 74295
2 Ga0466733_125763 3300042659 Bacteria 4828
3 Ga0466691_205598 3300042593 Bacteria 20201
4 Ga0466696_199566 3300042596 Bacteria 9051
5 Ga0466711_015225 3300042615 Bacteria 21110
6 Ga0466728_236110 3300042620 Bacteria 1302
7 Ga0466713_050170 3300042602 Bacteria 4532
8 Ga0466713_060148 3300042602 Bacteria 9794
9 Ga0466713_133388 3300042602 Bacteria 4493
10 Ga0466716_225187 3300042605 Bacteria 1875
11 Ga0466703_202228 3300042636 Bacteria 12788
12 Ga0466709_138818 3300042648 Bacteria 98089
13 Ga0466727_059128 3300042655 Bacteria 2210
14 Ga0466690_022456 3300042590 Bacteria 6122
15 Ga0466690_053388 3300042590 Bacteria 18157
16 Ga0466723_116408 3300042618 Unclassified 13439
17 Ga0466723_184325 3300042618 Bacteria 7069
18 Ga0466723_336862 3300042618 Bacteria 51262
19 Ga0466714_073904 3300042603 Bacteria 61298
20 Ga0466714_085794 3300042603 Bacteria 15566
21 Ga0466716_415147 3300042605 Bacteria 4391
22 IMNBL1DRAFT_c0006888 3300000062 Unclassified 6098
23 JGI24699J35502_11134197 3300002509 Bacteria 52215
24 Ga0068305_10003755 3300005083 Bacteria 24137
25 Ga0466703_273901 3300042636 Bacteria 9273
26 Ga0466704_242471 3300042643 Bacteria 6401
27 Ga0466709_106314 3300042648 Bacteria 11901
28 Ga0466727_308122 3300042655 Bacteria 9450
29 Ga0466733_004168 3300042659 Bacteria 3814
30 Ga0466715_175307 3300042616 Bacteria 2018
31 Ga0466728_077048 3300042620 Bacteria 8986
32 Ga0466706_288090 3300042599 Bacteria 45915
33 Ga0466713_106733 3300042602 Bacteria 4987
34 Ga0466719_023176 3300042606 Bacteria 5841
35 Ga0466697_056567 3300042611 Bacteria 485126
36 IMNBL1DRAFT_c0000550 3300000062 Bacteria 30486
37 Ga0466709_082215 3300042648 Bacteria 9766
38 Ga0466708_030500 3300042652 Bacteria 7885
39 Ga0466708_415351 3300042652 Bacteria 15043
40 Ga0466727_047493 3300042655 Bacteria 11773
41 Ga0466690_217857 3300042590 Bacteria 7588
42 Ga0466690_246794 3300042590 Bacteria 1923
43 Ga0466696_180262 3300042596 Bacteria 6435
44 Ga0466711_092050 3300042615 Bacteria 33984
45 Ga0466715_118628 3300042616 Bacteria 6566
46 Ga0466715_247902 3300042616 Bacteria 8227
47 Ga0466715_468183 3300042616 Unclassified 6882
48 Ga0466715_491159 3300042616 Bacteria 21907
49 Ga0466728_386665 3300042620 Bacteria 55152
50 Ga0466706_082173 3300042599 Bacteria 21336
51 Ga0466706_130182 3300042599 Bacteria 5359
52 Ga0466706_268279 3300042599 Bacteria 5694
53 Ga0466716_163384 3300042605 Bacteria 16200
54 2227555165 2225789004 Bacteria 14888
55 Ga0068305_10124034 3300005083 Unclassified 9144
56 Ga0466735_222452 3300042624 Bacteria 3844
57 Ga0466708_289889 3300042652 Unclassified 12729
58 Ga0466733_031111 3300042659 Bacteria 44698
59 Ga0466733_059945 3300042659 Bacteria 11444
60 Ga0466733_118635 3300042659 Bacteria 2165
61 Ga0466690_033397 3300042590 Bacteria 5539
62 Ga0466696_228385 3300042596 Bacteria 15316
63 Ga0466715_540931 3300042616 Bacteria 8372
64 Ga0466723_149381 3300042618 Bacteria 17438
65 Ga0466700_164572 3300042600 Bacteria 2438
66 Ga0466707_123401 3300042601 Bacteria 6795
67 Ga0466707_354114 3300042601 Bacteria 5164
68 Ga0466713_099183 3300042602 Bacteria 118109
69 Ga0466703_112835 3300042636 Bacteria 11705
70 Ga0466704_561838 3300042643 Bacteria 29338
71 Ga0466725_320152 3300042654 Bacteria 12291
72 Ga0466727_178574 3300042655 Bacteria 4997
73 Ga0466733_119077 3300042659 Bacteria 2327
74 Ga0466733_134600 3300042659 Bacteria 1956
75 Ga0160460_100002 3300012845 Bacteria 833437
76 Ga0123357_10071973 3300009784 Bacteria 4583
77 Ga0466706_053659 3300042599 Bacteria 18450
78 Ga0466716_098687 3300042605 Bacteria 12386
79 Ga0466722_083934 3300042609 Bacteria 2042
80 IMNBL1DRAFT_c0003781 3300000062 Bacteria 9463
81 IMNBL1DRAFT_c0012132 3300000062 Bacteria 3964
82 Ga0068302_10199549 3300005071 Unclassified 4166
83 Ga0068305_10030988 3300005083 Bacteria 9342
84 Ga0466697_087648 3300042611 Bacteria 2446
85 Ga0466735_099330 3300042624 Bacteria 1784
86 Ga0466708_461800 3300042652 Bacteria 46167
87 Ga0562377_0004 3300056842 Bacteria 3525959
88 Ga0466691_041731 3300042593 Bacteria 9611
89 Ga0466696_010174 3300042596 Bacteria 34499
90 Ga0466696_101849 3300042596 Bacteria 13014
91 Ga0466711_040811 3300042615 Bacteria 5309
92 Ga0466715_030319 3300042616 Bacteria 43703
93 Ga0466715_078429 3300042616 Bacteria 21717
94 Ga0466713_105837 3300042602 Bacteria 22694
95 Ga0466713_107023 3300042602 Bacteria 9055
96 Ga0466713_151406 3300042602 Bacteria 82944
97 2226988721 2225789003 Bacteria 7427
98 Ga0466705_000780 3300042612 Bacteria 13087
99 Ga0466705_102081 3300042612 Bacteria 2036
100 Ga0466730_065558 3300042625 Bacteria 4366
101 Ga0466704_161134 3300042643 Bacteria 14622
102 Ga0466733_065312 3300042659 Bacteria 101833
103 Ga0466690_430761 3300042590 Bacteria 14184
104 Ga0466695_194986 3300042595 Bacteria 3990
105 Ga0466711_049821 3300042615 Bacteria 2549
106 Ga0466715_271424 3300042616 Bacteria 5165
107 Ga0466715_604674 3300042616 Bacteria 12222
108 Ga0466726_091607 3300042619 Bacteria 8660
109 Ga0466726_117593 3300042619 Bacteria 2654
110 Ga0466706_155311 3300042599 Bacteria 8025
111 Ga0466706_178083 3300042599 Bacteria 37293
112 Ga0466713_018544 3300042602 Bacteria 4583
113 Ga0466713_129716 3300042602 Bacteria 104954
114 Ga0466716_494853 3300042605 Bacteria 13730
115 Ga0466719_228621 3300042606 Bacteria 11972
116 Ga0466722_032792 3300042609 Bacteria 5748
117 Ga0466722_180482 3300042609 Bacteria 8683
118 2227080821 2225789004 Bacteria 10122
119 IMNBL1DRAFT_c0019475 3300000062 Bacteria 2777
120 JGI24702J35022_10048756 3300002462 Bacteria 2255
121 Ga0123357_10001423 3300009784 Bacteria 25372
122 Ga0466735_120001 3300042624 Bacteria 6566
123 Ga0466703_167702 3300042636 Bacteria 5571
124 Ga0466703_382219 3300042636 Bacteria 2562
125 Ga0466724_32287 3300042649 Bacteria 2043
126 Ga0466725_114163 3300042654 Bacteria 7975

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_225187 Ga0466716_225187_90_1190 366
2 3300042620 Ga0466728_236110 Ga0466728_236110_86_1288 400
3 3300042618 Ga0466723_184325 Ga0466723_184325_1293_2534 413
4 3300042590 Ga0466690_033397 Ga0466690_033397_948_2273 418
5 3300042602 Ga0466713_060148 Ga0466713_060148_3911_5233 421
6 3300005083 Ga0068305_10030988 Ga0068305_100309885 422
7 3300005083 Ga0068305_10124034 Ga0068305_1012403411 423
8 3300042605 Ga0466716_163384 Ga0466716_163384_7253_8581 425
9 3300042593 Ga0466691_041731 Ga0466691_041731_1623_2909 428
10 3300042599 Ga0466706_130182 Ga0466706_130182_1297_2628 428
11 3300042618 Ga0466723_149381 Ga0466723_149381_4101_5426 428
12 3300042624 Ga0466735_099330 Ga0466735_099330_107_1432 428
13 3300042659 Ga0466733_053829 Ga0466733_053829_58360_59649 429
14 3300042659 Ga0466733_118635 Ga0466733_118635_647_1975 429
15 3300042659 Ga0466733_031111 Ga0466733_031111_30766_32091 430
16 3300042615 Ga0466711_040811 Ga0466711_040811_583_1908 431
17 3300042615 Ga0466711_092050 Ga0466711_092050_962_2287 431
18 3300042648 Ga0466709_138818 Ga0466709_138818_1032_2366 433
19 3300042595 Ga0466695_194986 Ga0466695_194986_1402_2709 435
20 3300005083 Ga0068305_10003755 Ga0068305_100037555 437
21 3300042590 Ga0466690_217857 Ga0466690_217857_1822_3141 439
22 3300042602 Ga0466713_018544 Ga0466713_018544_3182_4501 439
23 3300042602 Ga0466713_105837 Ga0466713_105837_8205_9527 440
24 3300042602 Ga0466713_106733 Ga0466713_106733_856_2178 440
25 3300042603 Ga0466714_073904 Ga0466714_073904_11460_12782 440
26 3300042605 Ga0466716_415147 Ga0466716_415147_1371_2693 440
27 3300042606 Ga0466719_228621 Ga0466719_228621_10102_11424 440
28 3300042616 Ga0466715_491159 Ga0466715_491159_13449_14771 440
29 3300042619 Ga0466726_117593 Ga0466726_117593_296_1618 440
30 3300042655 Ga0466727_059128 Ga0466727_059128_562_1884 440
31 3300042655 Ga0466727_178574 Ga0466727_178574_2429_3751 440
32 iso_pr_bacteria 2910942425 2910947154 440
33 iso_pr_bacteria 2910949487 2910950990 440
34 3300000062 IMNBL1DRAFT_c0019475 IMNBL1DRAFT_00194752 441
35 3300002462 JGI24702J35022_10048756 JGI24702J35022_100487561 441
36 3300005071 Ga0068302_10199549 Ga0068302_101995493 441
37 3300042600 Ga0466700_164572 Ga0466700_164572_645_1970 441
38 3300042601 Ga0466707_123401 Ga0466707_123401_2249_3574 441
39 3300042602 Ga0466713_050170 Ga0466713_050170_2275_3600 441
40 3300042616 Ga0466715_078429 Ga0466715_078429_1280_2605 441
41 3300042616 Ga0466715_247902 Ga0466715_247902_4196_5521 441
42 3300042619 Ga0466726_091607 Ga0466726_091607_4057_5382 441
43 3300042624 Ga0466735_120001 Ga0466735_120001_4727_6052 441
44 3300042624 Ga0466735_222452 Ga0466735_222452_452_1777 441
45 3300042636 Ga0466703_202228 Ga0466703_202228_10690_12015 441
46 3300042643 Ga0466704_242471 Ga0466704_242471_3728_5053 441
47 3300042648 Ga0466709_082215 Ga0466709_082215_2213_3538 441
48 3300042652 Ga0466708_030500 Ga0466708_030500_5501_6826 441
49 3300042652 Ga0466708_289889 Ga0466708_289889_7393_8718 441
50 3300042654 Ga0466725_320152 Ga0466725_320152_5145_6470 441
51 iso_pr_bacteria 2820741847 2820742972 441
52 iso_pr_bacteria 2920168565 2920168844 441
53 iso_pr_bacteria 2922326829 2922329392 441
54 iso_pr_bacteria 2940193328 2940194278 441
55 iso_pr_bacteria 2940205530 2940209153 441
56 iso_pr_bacteria 2940212447 2940216065 441
57 iso_pr_bacteria 2940298504 2940302119 441
58 iso_pr_bacteria 2940302308 2940305923 441
59 iso_pr_bacteria 2940306115 2940309769 441
60 iso_pr_bacteria 2940309933 2940313554 441
61 iso_pr_bacteria 2940313741 2940317422 441
62 iso_pr_bacteria 2940317558 2940321233 441
63 iso_pr_bacteria 2940321370 2940325046 441
64 iso_pr_bacteria 2940325180 2940328793 441
65 iso_pr_bacteria 2940328985 2940332600 441
66 iso_pr_bacteria 2940332795 2940336473 441
67 iso_pr_bacteria 2940336608 2940337553 441
68 iso_pr_bacteria 3004672520 3004676313 441
69 iso_pr_bacteria 3004677695 3004680008 441
70 2225789004 2227080821 2227455035 442
71 2225789004 2227555165 2228087598 442
72 3300009784 Ga0123357_10071973 Ga0123357_100719736 442
73 3300042590 Ga0466690_053388 Ga0466690_053388_5858_7186 442
74 3300042596 Ga0466696_180262 Ga0466696_180262_4642_5970 442
75 3300042596 Ga0466696_199566 Ga0466696_199566_5013_6341 442
76 3300042596 Ga0466696_228385 Ga0466696_228385_9977_11305 442
77 3300042601 Ga0466707_354114 Ga0466707_354114_2839_4167 442
78 3300042602 Ga0466713_099183 Ga0466713_099183_113664_114992 442
79 3300042605 Ga0466716_494853 Ga0466716_494853_10015_11343 442
80 3300042609 Ga0466722_083934 Ga0466722_083934_219_1547 442
81 3300042615 Ga0466711_049821 Ga0466711_049821_223_1551 442
82 3300042616 Ga0466715_118628 Ga0466715_118628_1436_2764 442
83 3300042618 Ga0466723_336862 Ga0466723_336862_5824_7152 442
84 3300042620 Ga0466728_386665 Ga0466728_386665_48379_49707 442
85 3300042636 Ga0466703_382219 Ga0466703_382219_654_1982 442
86 3300042648 Ga0466709_106314 Ga0466709_106314_6142_7470 442
87 3300042652 Ga0466708_461800 Ga0466708_461800_44531_45859 442
88 3300042655 Ga0466727_047493 Ga0466727_047493_4561_5889 442
89 3300042659 Ga0466733_004168 Ga0466733_004168_1492_2820 442
90 3300042659 Ga0466733_065312 Ga0466733_065312_53012_54340 442
91 3300042659 Ga0466733_119077 Ga0466733_119077_688_2016 442
92 3300056842 Ga0562377_0004 Ga0562377_0004_1656335_1657663 442
93 iso_pr_bacteria 2695420317 2695483221 442
94 iso_pr_bacteria 2695420931 2698111713 442
95 iso_pr_bacteria 2820778767 2820779865 442
96 iso_pr_bacteria 2873600114 2873600266 442
97 iso_pr_bacteria 2873610414 2873610639 442
98 iso_pr_bacteria 2910926975 2910927544 442
99 iso_pr_bacteria 2910959314 2910960820 442
100 iso_pr_bacteria 2923982719 2923983883 442
101 iso_pr_bacteria 2940199050 2940201522 442
102 iso_pr_bacteria 2940209341 2940210624 442
103 iso_pr_bacteria 2940248789 2940249268 442
104 iso_pr_bacteria 2940253009 2940256198 442
105 iso_pr_bacteria 2940257232 2940257234 442
106 iso_pr_bacteria 2940346213 2940348661 442
107 iso_pr_bacteria 2940371297 2940373535 442
108 iso_pr_bacteria 3004667792 3004670838 442
109 iso_pr_bacteria 8100157865 8100159840 442
110 3300000062 IMNBL1DRAFT_c0000550 IMNBL1DRAFT_000055017 443
111 3300000062 IMNBL1DRAFT_c0012132 IMNBL1DRAFT_00121324 443
112 3300009784 Ga0123357_10001423 Ga0123357_1000142314 443
113 3300042590 Ga0466690_022456 Ga0466690_022456_3500_4831 443
114 3300042596 Ga0466696_101849 Ga0466696_101849_9393_10724 443
115 3300042599 Ga0466706_178083 Ga0466706_178083_22633_23964 443
116 3300042602 Ga0466713_107023 Ga0466713_107023_6980_8311 443
117 3300042602 Ga0466713_129716 Ga0466713_129716_65651_66982 443
118 3300042602 Ga0466713_133388 Ga0466713_133388_1820_3151 443
119 3300042606 Ga0466719_023176 Ga0466719_023176_355_1686 443
120 3300042611 Ga0466697_056567 Ga0466697_056567_474431_475762 443
121 3300042612 Ga0466705_000780 Ga0466705_000780_11106_12437 443
122 3300042618 Ga0466723_116408 Ga0466723_116408_1010_2341 443
123 3300042636 Ga0466703_112835 Ga0466703_112835_83_1414 443
124 3300042643 Ga0466704_561838 Ga0466704_561838_20259_21590 443
125 3300042649 Ga0466724_32287 Ga0466724_32287_155_1486 443
126 3300042654 Ga0466725_114163 Ga0466725_114163_186_1517 443
127 3300042659 Ga0466733_134600 Ga0466733_134600_415_1746 443
128 iso_pr_bacteria 2695420314 2695473914 443
129 iso_pr_bacteria 2910930387 2910932342 443
130 3300000062 IMNBL1DRAFT_c0003781 IMNBL1DRAFT_00037812 444
131 3300000062 IMNBL1DRAFT_c0006888 IMNBL1DRAFT_00068883 444
132 3300042596 Ga0466696_010174 Ga0466696_010174_27987_29321 444
133 3300042599 Ga0466706_268279 Ga0466706_268279_4128_5462 444
134 3300042602 Ga0466713_151406 Ga0466713_151406_81098_82432 444
135 3300042609 Ga0466722_032792 Ga0466722_032792_3989_5323 444
136 3300042616 Ga0466715_030319 Ga0466715_030319_18173_19507 444
137 3300042616 Ga0466715_468183 Ga0466715_468183_5110_6444 444
138 3300042616 Ga0466715_540931 Ga0466715_540931_938_2272 444
139 3300042659 Ga0466733_125763 Ga0466733_125763_2479_3813 444
140 iso_pr_bacteria 8100166142 8100171083 444
141 2225789003 2226988721 2227337746 445
142 iso_pr_bacteria 2820757377 2820759326 445
143 3300002509 JGI24699J35502_11134197 JGI24699J35502_1113419734 446
144 3300042599 Ga0466706_082173 Ga0466706_082173_13543_14886 447
145 3300042599 Ga0466706_155311 Ga0466706_155311_758_2101 447
146 3300042611 Ga0466697_087648 Ga0466697_087648_412_1782 447
147 iso_pr_bacteria 2609459943 2610740711 447
148 3300042590 Ga0466690_430761 Ga0466690_430761_638_1984 448
149 3300042616 Ga0466715_271424 Ga0466715_271424_89_1435 448
150 3300042636 Ga0466703_167702 Ga0466703_167702_2587_3933 448
151 3300042643 Ga0466704_161134 Ga0466704_161134_9547_10893 448
152 3300042652 Ga0466708_415351 Ga0466708_415351_13581_14927 448
153 iso_pr_bacteria 2830041218 2830042987 448
154 3300042593 Ga0466691_205598 Ga0466691_205598_5510_6859 449
155 3300042603 Ga0466714_085794 Ga0466714_085794_11859_13208 449
156 3300042659 Ga0466733_059945 Ga0466733_059945_9312_10661 449
157 3300042599 Ga0466706_288090 Ga0466706_288090_37206_38558 450
158 3300042605 Ga0466716_098687 Ga0466716_098687_1192_2544 450
159 3300042590 Ga0466690_246794 Ga0466690_246794_451_1806 451
160 3300042609 Ga0466722_180482 Ga0466722_180482_3498_4853 451
161 3300042616 Ga0466715_175307 Ga0466715_175307_20_1375 451
162 3300042636 Ga0466703_273901 Ga0466703_273901_3291_4646 451
163 iso_pr_bacteria 2940202316 2940204730 451
164 3300042612 Ga0466705_102081 Ga0466705_102081_40_1401 453
165 3300042655 Ga0466727_308122 Ga0466727_308122_5050_6411 453
166 iso_pr_bacteria 2940195863 2940197320 453
167 3300042625 Ga0466730_065558 Ga0466730_065558_2625_4001 458
168 3300012845 Ga0160460_100002 Ga0160460_100002157 461
169 3300042616 Ga0466715_604674 Ga0466715_604674_6609_8000 463
170 3300042599 Ga0466706_053659 Ga0466706_053659_15292_16698 468
171 3300042620 Ga0466728_077048 Ga0466728_077048_482_1912 476
172 3300042615 Ga0466711_015225 Ga0466711_015225_13447_14997 504

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01966 HD HD domain 124 211 0.84
PF13286 HD_assoc Phosphohydrolase-associated domain 409 495 0.74

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.