Protein Family IF07445

Metagenome Isolate
198 Members
42 Samples
195 Scaffolds
197.11 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_011375|Ga0466711_011375_6044_6751
Length
235 aa
Sequence
MGTDVDPGKSDKRRRTGTESGRKPQMERIFFQTKTYVAMTLEKECETIALSSEQLIEDFDCGNDDLNDFFNHDAIKYQEQLMCQTYFFRHYETGKVVCAFSLSADSLKAAWLPGSRRKKVKELIPREKNLQSYPAFLIGRLGVAVEFGNQGIGSQLLEAVKQLCSSNYSNLARFLLVDAYNEPSVLHYYRKNGFDIVFTTDEQERDYYKRPDTTDPLRTRFLFYDMIKQKNNSVD

📊 Sample Types

Isolate 1.0%
Metagenome 99.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.3%
Kalotermitidae 26.8%
Unclassified 12.2%
Rhinotermitidae 7.3%
Termopsidae 4.9%
Hodotermitidae 2.4%

🌳 Taxonomy

Archaea 1
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 53

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
31 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_174111 3300042592 Bacteria 1076
2 Ga0466691_048799 3300042593 Bacteria 2124
3 Ga0466694_035487 3300042594 Bacteria 1791
4 Ga0466695_193562 3300042595 Bacteria 1308
5 Ga0123357_10053262 3300009784 Bacteria 5459
6 Ga0123356_10062512 3300010049 Bacteria 3478
7 Ga0123356_10227038 3300010049 Bacteria 1928
8 Ga0123356_10235321 3300010049 Bacteria 1899
9 Ga0123356_10967997 3300010049 Unclassified 1021
10 Ga0123353_10186390 3300010167 Bacteria 3281
11 Ga0123353_11409903 3300010167 Bacteria 895
12 Ga0123353_11509052 3300010167 Unclassified 855
13 Ga0123354_10739855 3300010882 Bacteria 676
14 JGI24702J35022_10029112 3300002462 Bacteria 2964
15 JGI24702J35022_10215798 3300002462 Bacteria 1103
16 Ga0072941_1103370 3300005201 Bacteria 26509
17 Ga0466711_012084 3300042615 Bacteria 2141
18 Ga0466711_316032 3300042615 Bacteria 8056
19 Ga0466711_423922 3300042615 Bacteria 4599
20 Ga0466726_022152 3300042619 Bacteria 1470
21 Ga0466726_035127 3300042619 Unclassified 1038
22 Ga0466701_072011 3300042598 Bacteria 1082
23 Ga0466706_140297 3300042599 Unclassified 1311
24 Ga0466713_008308 3300042602 Bacteria 16061
25 Ga0466697_064327 3300042611 Bacteria 3003
26 Ga0466697_073533 3300042611 Bacteria 3362
27 Ga0466705_088700 3300042612 Bacteria 3069
28 Ga0466705_386629 3300042612 Bacteria 7874
29 Ga0466727_041687 3300042655 Bacteria 11156
30 Ga0466690_365165 3300042590 Bacteria 1438
31 Ga0466692_158227 3300042591 Bacteria 7235
32 Ga0466694_051792 3300042594 Bacteria 23896
33 Ga0466701_009614 3300042598 Bacteria 1023
34 Ga0123357_10007841 3300009784 Bacteria 13263
35 Ga0123357_10040062 3300009784 Bacteria 6374
36 Ga0123357_10453824 3300009784 Bacteria 1109
37 Ga0123356_10672092 3300010049 Unclassified 1204
38 Ga0123356_10855712 3300010049 Bacteria 1081
39 Ga0123356_11264299 3300010049 Unclassified 902
40 Ga0123353_11486673 3300010167 Unclassified 864
41 Ga0123354_10186727 3300010882 Unclassified 2341
42 JGI24702J35022_10048750 3300002462 Bacteria 2255
43 JGI24696J40584_12914547 3300002834 Bacteria 1286
44 Ga0072941_1262059 3300005201 Bacteria 2735
45 Ga0466711_279330 3300042615 Bacteria 5889
46 Ga0466728_224666 3300042620 Bacteria 1239
47 Ga0466729_010983 3300042621 Bacteria 2335
48 Ga0466707_078430 3300042601 Bacteria 24150
49 Ga0466707_225146 3300042601 Unclassified 2952
50 Ga0466698_388029 3300042610 Unclassified 1786
51 Ga0466705_191189 3300042612 Unclassified 2048
52 Ga0466703_182462 3300042636 Bacteria 1561
53 Ga0466709_202217 3300042648 Unclassified 2098
54 Ga0466693_111815 3300042592 Bacteria 3655
55 Ga0123357_10109732 3300009784 Bacteria 3524
56 Ga0123356_10085837 3300010049 Bacteria 2987
57 Ga0123356_10484074 3300010049 Bacteria 1391
58 Ga0123356_10510854 3300010049 Bacteria 1359
59 Ga0123356_10866133 3300010049 Bacteria 1075
60 Ga0123353_11823580 3300010167 Bacteria 755
61 Ga0123354_10440741 3300010882 Unclassified 1064
62 JGI24702J35022_10172480 3300002462 Bacteria 1224
63 Ga0466711_042994 3300042615 Bacteria 1869
64 Ga0466711_253521 3300042615 Unclassified 1351
65 Ga0466728_420703 3300042620 Unclassified 13130
66 Ga0466701_051802 3300042598 Bacteria 1017
67 Ga0466707_146061 3300042601 Bacteria 7438
68 Ga0466698_378256 3300042610 Bacteria 2121
69 Ga0466698_383890 3300042610 Bacteria 1112
70 Ga0466705_063934 3300042612 Unclassified 5588
71 Ga0466731_335812 3300042622 Unclassified 1088
72 Ga0466703_211194 3300042636 Bacteria 16156
73 Ga0466704_038354 3300042643 Unclassified 2162
74 Ga0466704_349977 3300042643 Unclassified 1640
75 Ga0466727_132422 3300042655 Archaea 1032
76 Ga0466727_289151 3300042655 Bacteria 1224
77 Ga0466691_054231 3300042593 Unclassified 5562
78 Ga0466694_402033 3300042594 Bacteria 1199
79 Ga0123357_10057710 3300009784 Bacteria 5215
80 Ga0123356_10118930 3300010049 Bacteria 2566
81 Ga0123356_10143892 3300010049 Bacteria 2356
82 Ga0123356_10470437 3300010049 Bacteria 1408
83 Ga0123356_10537275 3300010049 Bacteria 1329
84 Ga0123356_11319831 3300010049 Unclassified 884
85 Ga0123353_10148942 3300010167 Bacteria 3739
86 Ga0123353_10664695 3300010167 Bacteria 1471
87 Ga0123353_11553546 3300010167 Unclassified 839
88 JGI24705J35276_12138182 3300002504 Bacteria 1130
89 JGI24696J40584_12897043 3300002834 Bacteria 1162
90 Ga0466711_247858 3300042615 Bacteria 2657
91 Ga0466707_201937 3300042601 Bacteria 9392
92 Ga0466719_142668 3300042606 Bacteria 4780
93 Ga0466698_272739 3300042610 Bacteria 1001
94 Ga0466697_010061 3300042611 Unclassified 1616
95 Ga0466697_143341 3300042611 Bacteria 2182
96 Ga0466705_012572 3300042612 Unclassified 1299
97 Ga0466705_181292 3300042612 Bacteria 2605
98 Ga0466727_044289 3300042655 Unclassified 1007
99 Ga0123357_10427274 3300009784 Bacteria 1175
100 Ga0123356_10392934 3300010049 Bacteria 1522
101 Ga0123353_10555386 3300010167 Unclassified 1655
102 JGI24705J35276_12197093 3300002504 Bacteria 1550
103 Ga0068305_10261752 3300005083 Bacteria 3778
104 Ga0123357_10000423 3300009784 Bacteria 40429
105 Ga0466711_011375 3300042615 Bacteria 7530
106 Ga0466711_188202 3300042615 Bacteria 2546
107 Ga0466711_318243 3300042615 Unclassified 1374
108 Ga0466726_072886 3300042619 Bacteria 1537
109 Ga0466726_167731 3300042619 Bacteria 1135
110 Ga0466713_012999 3300042602 Bacteria 28859
111 Ga0466719_332669 3300042606 Bacteria 1433
112 Ga0466719_529602 3300042606 Bacteria 1372
113 Ga0466721_245609 3300042608 Unclassified 1883
114 Ga0466721_297142 3300042608 Bacteria 1275
115 Ga0466722_061239 3300042609 Bacteria 2786
116 Ga0466697_066625 3300042611 Bacteria 2028
117 Ga0466705_017689 3300042612 Unclassified 1637
118 Ga0466705_170464 3300042612 Unclassified 1446
119 Ga0466704_046090 3300042643 Unclassified 1770
120 Ga0466704_065138 3300042643 Bacteria 23110
121 Ga0466709_173719 3300042648 Unclassified 6922
122 Ga0466691_014734 3300042593 Bacteria 1602
123 Ga0123356_10549054 3300010049 Unclassified 1316
124 Ga0123356_10641382 3300010049 Bacteria 1229
125 Ga0123356_11049197 3300010049 Bacteria 984
126 Ga0123353_10267428 3300010167 Bacteria 2637
127 Ga0123354_10011630 3300010882 Bacteria 13620
128 Ga0123354_10398479 3300010882 Unclassified 1168
129 JGI24705J35276_12054704 3300002504 Unclassified 925
130 JGI24699J35502_11134230 3300002509 Bacteria 99108
131 JGI24696J40584_12794972 3300002834 Unclassified 859
132 JGI24696J40584_12901872 3300002834 Unclassified 1191
133 Ga0466711_127987 3300042615 Bacteria 1257
134 Ga0466711_247864 3300042615 Bacteria 3046
135 Ga0466711_455972 3300042615 Bacteria 4129
136 Ga0466711_459622 3300042615 Bacteria 1669
137 Ga0466723_129513 3300042618 Bacteria 70343
138 Ga0466726_203661 3300042619 Bacteria 1361
139 Ga0466726_469148 3300042619 Bacteria 1098
140 Ga0466728_144965 3300042620 Bacteria 4745
141 Ga0466701_102184 3300042598 Bacteria 3434
142 Ga0466717_162555 3300042604 Bacteria 1868
143 Ga0466719_397368 3300042606 Bacteria 1082
144 Ga0466698_077653 3300042610 Unclassified 1297
145 Ga0466698_255236 3300042610 Bacteria 1093
146 Ga0466732_329828 3300042656 Bacteria 1729
147 Ga0466731_163602 3300042622 Bacteria 1564
148 Ga0466703_314096 3300042636 Unclassified 1388
149 Ga0466704_143780 3300042643 Unclassified 1632
150 Ga0466708_046971 3300042652 Unclassified 1015
151 Ga0466692_143062 3300042591 Unclassified 3842
152 Ga0466691_206507 3300042593 Bacteria 10588
153 Ga0466694_198626 3300042594 Bacteria 1441
154 Ga0466694_376414 3300042594 Unclassified 1488
155 Ga0466701_011772 3300042598 Bacteria 3029
156 Ga0123357_10288657 3300009784 Bacteria 1680
157 Ga0123356_10794528 3300010049 Bacteria 1117
158 Ga0123354_10000991 3300010882 Bacteria 32314
159 Ga0123354_10119059 3300010882 Bacteria 3423
160 Ga0123354_10205679 3300010882 Bacteria 2147
161 JGI24702J35022_10096506 3300002462 Bacteria 1614
162 JGI24705J35276_12191535 3300002504 Bacteria 1476
163 JGI24696J40584_12888180 3300002834 Unclassified 1117
164 Ga0466711_070716 3300042615 Bacteria 14651
165 Ga0466711_325789 3300042615 Bacteria 11504
166 Ga0466726_255132 3300042619 Bacteria 1217
167 Ga0466726_391226 3300042619 Unclassified 1441
168 Ga0466707_023924 3300042601 Unclassified 13043
169 Ga0466698_136320 3300042610 Unclassified 1024
170 Ga0466697_270102 3300042611 Bacteria 1329
171 Ga0466731_281983 3300042622 Bacteria 1340
172 Ga0466704_038598 3300042643 Unclassified 1824
173 Ga0466727_038603 3300042655 Bacteria 1952
174 Ga0466690_380914 3300042590 Bacteria 1439
175 Ga0466693_195592 3300042592 Bacteria 1226
176 Ga0466694_162704 3300042594 Unclassified 1222
177 Ga0466694_320268 3300042594 Bacteria 1218
178 Ga0123357_10063836 3300009784 Bacteria 4924
179 Ga0123357_10137515 3300009784 Unclassified 3015
180 Ga0123355_10240324 3300009826 Bacteria 2567
181 Ga0123356_10029360 3300010049 Bacteria 5150
182 Ga0123353_10655013 3300010167 Bacteria 1486
183 Ga0123353_10709875 3300010167 Bacteria 1409
184 Ga0123354_10154756 3300010882 Bacteria 2757
185 Ga0123354_10195913 3300010882 Bacteria 2242
186 JGI24702J35022_10281879 3300002462 Bacteria 976
187 JGI24702J35022_10404382 3300002462 Unclassified 825
188 JGI24696J40584_12823311 3300002834 Unclassified 913
189 Ga0466729_194578 3300042621 Bacteria 12153
190 Ga0466719_143915 3300042606 Bacteria 6860
191 Ga0466719_446191 3300042606 Bacteria 1108
192 Ga0466722_255876 3300042609 Bacteria 1089
193 Ga0466698_100579 3300042610 Bacteria 1070
194 Ga0466704_499975 3300042643 Bacteria 3000
195 Ga0466708_041633 3300042652 Unclassified 1518

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_009614 Ga0466701_009614_205_795 181
2 3300042655 Ga0466727_289151 Ga0466727_289151_311_871 186
3 3300042610 Ga0466698_136320 Ga0466698_136320_45_608 187
4 3300042611 Ga0466697_066625 Ga0466697_066625_792_1355 187
5 3300002462 JGI24702J35022_10404382 JGI24702J35022_104043821 188
6 3300042621 Ga0466729_194578 Ga0466729_194578_5702_6277 191
7 3300042619 Ga0466726_035127 Ga0466726_035127_282_860 192
8 3300002462 JGI24702J35022_10096506 JGI24702J35022_100965062 193
9 3300010049 Ga0123356_10118930 Ga0123356_101189304 193
10 3300042592 Ga0466693_174111 Ga0466693_174111_136_717 193
11 3300042606 Ga0466719_143915 Ga0466719_143915_1559_2140 193
12 3300042611 Ga0466697_064327 Ga0466697_064327_260_841 193
13 3300042615 Ga0466711_247858 Ga0466711_247858_1615_2196 193
14 3300042615 Ga0466711_316032 Ga0466711_316032_622_1203 193
15 3300042615 Ga0466711_423922 Ga0466711_423922_1047_1628 193
16 3300042619 Ga0466726_167731 Ga0466726_167731_88_669 193
17 3300042619 Ga0466726_203661 Ga0466726_203661_531_1112 193
18 3300002834 JGI24696J40584_12794972 JGI24696J40584_127949722 194
19 3300010049 Ga0123356_11049197 Ga0123356_110491971 194
20 3300042601 Ga0466707_146061 Ga0466707_146061_413_997 194
21 3300042601 Ga0466707_201937 Ga0466707_201937_2335_2919 194
22 3300042611 Ga0466697_143341 Ga0466697_143341_621_1205 194
23 3300042612 Ga0466705_012572 Ga0466705_012572_199_783 194
24 3300042615 Ga0466711_127987 Ga0466711_127987_265_849 194
25 3300042615 Ga0466711_188202 Ga0466711_188202_752_1336 194
26 3300042615 Ga0466711_253521 Ga0466711_253521_254_838 194
27 3300042615 Ga0466711_279330 Ga0466711_279330_4870_5454 194
28 3300042615 Ga0466711_318243 Ga0466711_318243_600_1184 194
29 3300042615 Ga0466711_455972 Ga0466711_455972_2842_3426 194
30 3300042619 Ga0466726_022152 Ga0466726_022152_16_600 194
31 3300042620 Ga0466728_144965 Ga0466728_144965_2887_3471 194
32 3300042622 Ga0466731_335812 Ga0466731_335812_483_1067 194
33 3300042636 Ga0466703_314096 Ga0466703_314096_554_1138 194
34 3300042643 Ga0466704_038598 Ga0466704_038598_366_950 194
35 3300042652 Ga0466708_041633 Ga0466708_041633_531_1115 194
36 3300009784 Ga0123357_10057710 Ga0123357_100577103 195
37 3300010167 Ga0123353_10655013 Ga0123353_106550133 195
38 3300042602 Ga0466713_012999 Ga0466713_012999_22904_23491 195
39 3300042612 Ga0466705_170464 Ga0466705_170464_712_1299 195
40 3300042612 Ga0466705_386629 Ga0466705_386629_3921_4508 195
41 3300042619 Ga0466726_072886 Ga0466726_072886_508_1095 195
42 3300042655 Ga0466727_132422 Ga0466727_132422_120_707 195
43 3300002462 JGI24702J35022_10048750 JGI24702J35022_100487503 196
44 3300005201 Ga0072941_1262059 Ga0072941_12620594 196
45 3300010167 Ga0123353_11409903 Ga0123353_114099031 196
46 3300042590 Ga0466690_365165 Ga0466690_365165_492_1082 196
47 3300042590 Ga0466690_380914 Ga0466690_380914_491_1081 196
48 3300042591 Ga0466692_143062 Ga0466692_143062_74_664 196
49 3300042593 Ga0466691_014734 Ga0466691_014734_455_1045 196
50 3300042593 Ga0466691_048799 Ga0466691_048799_1191_1781 196
51 3300042594 Ga0466694_035487 Ga0466694_035487_127_717 196
52 3300042594 Ga0466694_162704 Ga0466694_162704_174_764 196
53 3300042594 Ga0466694_198626 Ga0466694_198626_501_1091 196
54 3300042594 Ga0466694_320268 Ga0466694_320268_56_646 196
55 3300042594 Ga0466694_376414 Ga0466694_376414_413_1003 196
56 3300042598 Ga0466701_102184 Ga0466701_102184_183_773 196
57 3300042611 Ga0466697_073533 Ga0466697_073533_1130_1720 196
58 3300042612 Ga0466705_063934 Ga0466705_063934_683_1273 196
59 3300042612 Ga0466705_181292 Ga0466705_181292_639_1229 196
60 3300042619 Ga0466726_255132 Ga0466726_255132_574_1164 196
61 3300042619 Ga0466726_391226 Ga0466726_391226_314_904 196
62 3300042620 Ga0466728_224666 Ga0466728_224666_528_1118 196
63 3300042622 Ga0466731_281983 Ga0466731_281983_31_621 196
64 3300042636 Ga0466703_211194 Ga0466703_211194_15430_16020 196
65 3300042643 Ga0466704_038354 Ga0466704_038354_690_1280 196
66 3300042655 Ga0466727_041687 Ga0466727_041687_9724_10314 196
67 3300042655 Ga0466727_044289 Ga0466727_044289_129_719 196
68 3300042656 Ga0466732_329828 Ga0466732_329828_879_1469 196
69 iso_pr_bacteria 2820757377 2820759977 196
70 3300002462 JGI24702J35022_10172480 JGI24702J35022_101724802 197
71 3300002462 JGI24702J35022_10281879 JGI24702J35022_102818792 197
72 3300002504 JGI24705J35276_12054704 JGI24705J35276_120547041 197
73 3300002504 JGI24705J35276_12191535 JGI24705J35276_121915352 197
74 3300002504 JGI24705J35276_12197093 JGI24705J35276_121970933 197
75 3300002509 JGI24699J35502_11134230 JGI24699J35502_1113423070 197
76 3300002834 JGI24696J40584_12888180 JGI24696J40584_128881801 197
77 3300005201 Ga0072941_1103370 Ga0072941_110337025 197
78 3300009784 Ga0123357_10000423 Ga0123357_1000042312 197
79 3300009784 Ga0123357_10040062 Ga0123357_100400624 197
80 3300009784 Ga0123357_10053262 Ga0123357_100532625 197
81 3300009784 Ga0123357_10063836 Ga0123357_100638365 197
82 3300009784 Ga0123357_10137515 Ga0123357_101375151 197
83 3300009784 Ga0123357_10288657 Ga0123357_102886572 197
84 3300009784 Ga0123357_10427274 Ga0123357_104272742 197
85 3300010049 Ga0123356_10143892 Ga0123356_101438922 197
86 3300010049 Ga0123356_10235321 Ga0123356_102353212 197
87 3300010049 Ga0123356_10392934 Ga0123356_103929342 197
88 3300010049 Ga0123356_10484074 Ga0123356_104840741 197
89 3300010049 Ga0123356_10641382 Ga0123356_106413822 197
90 3300010049 Ga0123356_10672092 Ga0123356_106720922 197
91 3300010049 Ga0123356_10866133 Ga0123356_108661331 197
92 3300010167 Ga0123353_10709875 Ga0123353_107098752 197
93 3300010167 Ga0123353_11486673 Ga0123353_114866732 197
94 3300010882 Ga0123354_10000991 Ga0123354_1000099117 197
95 3300010882 Ga0123354_10195913 Ga0123354_101959132 197
96 3300010882 Ga0123354_10205679 Ga0123354_102056792 197
97 3300010882 Ga0123354_10440741 Ga0123354_104407412 197
98 3300010882 Ga0123354_10739855 Ga0123354_107398551 197
99 3300042591 Ga0466692_158227 Ga0466692_158227_904_1497 197
100 3300042593 Ga0466691_054231 Ga0466691_054231_4583_5176 197
101 3300042594 Ga0466694_051792 Ga0466694_051792_23025_23618 197
102 3300042594 Ga0466694_402033 Ga0466694_402033_498_1091 197
103 3300042598 Ga0466701_051802 Ga0466701_051802_282_875 197
104 3300042601 Ga0466707_023924 Ga0466707_023924_89_682 197
105 3300042601 Ga0466707_225146 Ga0466707_225146_1909_2502 197
106 3300042602 Ga0466713_008308 Ga0466713_008308_4416_5009 197
107 3300042604 Ga0466717_162555 Ga0466717_162555_1103_1696 197
108 3300042606 Ga0466719_142668 Ga0466719_142668_2220_2813 197
109 3300042606 Ga0466719_332669 Ga0466719_332669_570_1163 197
110 3300042606 Ga0466719_397368 Ga0466719_397368_386_979 197
111 3300042606 Ga0466719_446191 Ga0466719_446191_282_875 197
112 3300042608 Ga0466721_297142 Ga0466721_297142_291_884 197
113 3300042610 Ga0466698_077653 Ga0466698_077653_436_1029 197
114 3300042610 Ga0466698_100579 Ga0466698_100579_393_986 197
115 3300042610 Ga0466698_255236 Ga0466698_255236_167_760 197
116 3300042610 Ga0466698_378256 Ga0466698_378256_571_1164 197
117 3300042611 Ga0466697_010061 Ga0466697_010061_320_913 197
118 3300042612 Ga0466705_191189 Ga0466705_191189_1255_1848 197
119 3300042615 Ga0466711_070716 Ga0466711_070716_10199_10792 197
120 3300042618 Ga0466723_129513 Ga0466723_129513_65397_65990 197
121 3300042620 Ga0466728_420703 Ga0466728_420703_2799_3392 197
122 3300042621 Ga0466729_010983 Ga0466729_010983_1650_2243 197
123 3300042622 Ga0466731_163602 Ga0466731_163602_599_1192 197
124 3300042636 Ga0466703_182462 Ga0466703_182462_577_1170 197
125 3300042643 Ga0466704_046090 Ga0466704_046090_858_1451 197
126 3300042643 Ga0466704_065138 Ga0466704_065138_10578_11171 197
127 3300042643 Ga0466704_143780 Ga0466704_143780_360_953 197
128 3300042648 Ga0466709_173719 Ga0466709_173719_5885_6478 197
129 3300042648 Ga0466709_202217 Ga0466709_202217_807_1400 197
130 3300042652 Ga0466708_046971 Ga0466708_046971_106_699 197
131 iso_pr_bacteria 2820741847 2820742341 197
132 3300002462 JGI24702J35022_10029112 JGI24702J35022_100291121 198
133 3300002504 JGI24705J35276_12138182 JGI24705J35276_121381822 198
134 3300002834 JGI24696J40584_12897043 JGI24696J40584_128970431 198
135 3300002834 JGI24696J40584_12914547 JGI24696J40584_129145471 198
136 3300005083 Ga0068305_10261752 Ga0068305_102617524 198
137 3300009784 Ga0123357_10007841 Ga0123357_1000784110 198
138 3300009784 Ga0123357_10109732 Ga0123357_101097323 198
139 3300009784 Ga0123357_10453824 Ga0123357_104538242 198
140 3300009826 Ga0123355_10240324 Ga0123355_102403243 198
141 3300010049 Ga0123356_10029360 Ga0123356_100293604 198
142 3300010049 Ga0123356_10470437 Ga0123356_104704372 198
143 3300010049 Ga0123356_10537275 Ga0123356_105372751 198
144 3300010049 Ga0123356_10549054 Ga0123356_105490543 198
145 3300010049 Ga0123356_10794528 Ga0123356_107945282 198
146 3300010049 Ga0123356_10855712 Ga0123356_108557122 198
147 3300010049 Ga0123356_10967997 Ga0123356_109679972 198
148 3300010167 Ga0123353_10267428 Ga0123353_102674283 198
149 3300010167 Ga0123353_10664695 Ga0123353_106646952 198
150 3300010167 Ga0123353_11509052 Ga0123353_115090522 198
151 3300010167 Ga0123353_11823580 Ga0123353_118235801 198
152 3300010882 Ga0123354_10011630 Ga0123354_1001163011 198
153 3300010882 Ga0123354_10119059 Ga0123354_101190592 198
154 3300010882 Ga0123354_10154756 Ga0123354_101547563 198
155 3300010882 Ga0123354_10186727 Ga0123354_101867272 198
156 3300010882 Ga0123354_10398479 Ga0123354_103984792 198
157 3300042592 Ga0466693_111815 Ga0466693_111815_375_971 198
158 3300042592 Ga0466693_195592 Ga0466693_195592_516_1112 198
159 3300042593 Ga0466691_206507 Ga0466691_206507_2201_2797 198
160 3300042594 Ga0466694_051792 Ga0466694_051792_6547_7143 198
161 3300042595 Ga0466695_193562 Ga0466695_193562_493_1089 198
162 3300042598 Ga0466701_072011 Ga0466701_072011_466_1062 198
163 3300042601 Ga0466707_078430 Ga0466707_078430_820_1416 198
164 3300042606 Ga0466719_529602 Ga0466719_529602_331_927 198
165 3300042610 Ga0466698_272739 Ga0466698_272739_349_945 198
166 3300042610 Ga0466698_388029 Ga0466698_388029_823_1419 198
167 3300042611 Ga0466697_270102 Ga0466697_270102_631_1227 198
168 3300042612 Ga0466705_088700 Ga0466705_088700_554_1150 198
169 3300042615 Ga0466711_042994 Ga0466711_042994_716_1312 198
170 3300010049 Ga0123356_10227038 Ga0123356_102270382 199
171 3300010049 Ga0123356_10510854 Ga0123356_105108542 199
172 3300010049 Ga0123356_11264299 Ga0123356_112642992 199
173 3300010167 Ga0123353_10148942 Ga0123353_101489423 199
174 3300010167 Ga0123353_10186390 Ga0123353_101863903 199
175 3300010167 Ga0123353_10555386 Ga0123353_105553861 199
176 3300010167 Ga0123353_11553546 Ga0123353_115535462 199
177 3300042608 Ga0466721_245609 Ga0466721_245609_1073_1672 199
178 3300042612 Ga0466705_017689 Ga0466705_017689_398_997 199
179 3300042615 Ga0466711_012084 Ga0466711_012084_1433_2032 199
180 3300042643 Ga0466704_349977 Ga0466704_349977_762_1361 199
181 3300042643 Ga0466704_499975 Ga0466704_499975_32_631 199
182 3300010049 Ga0123356_10062512 Ga0123356_100625122 200
183 3300010049 Ga0123356_11319831 Ga0123356_113198312 200
184 3300042598 Ga0466701_011772 Ga0466701_011772_200_802 200
185 3300042599 Ga0466706_140297 Ga0466706_140297_98_700 200
186 3300042609 Ga0466722_255876 Ga0466722_255876_165_767 200
187 3300042609 Ga0466722_061239 Ga0466722_061239_1785_2390 201
188 3300042619 Ga0466726_469148 Ga0466726_469148_334_939 201
189 3300002462 JGI24702J35022_10215798 JGI24702J35022_102157982 202
190 3300002834 JGI24696J40584_12901872 JGI24696J40584_129018722 202
191 3300042615 Ga0466711_247864 Ga0466711_247864_1530_2141 203
192 3300042655 Ga0466727_038603 Ga0466727_038603_96_710 204
193 3300002834 JGI24696J40584_12823311 JGI24696J40584_128233112 207
194 3300042615 Ga0466711_325789 Ga0466711_325789_695_1318 207
195 3300042610 Ga0466698_383890 Ga0466698_383890_445_1074 209
196 3300010049 Ga0123356_10085837 Ga0123356_100858372 218
197 3300042615 Ga0466711_459622 Ga0466711_459622_773_1438 221
198 3300042615 Ga0466711_011375 Ga0466711_011375_6044_6751 235

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 133 194 0.85
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 139 195 0.69

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00583 GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
5xun-assembly1.cif.gz_A Crystal structure of Y145F mutant of KacT 0.857 43 232
6gtq-assembly2.cif.gz_B Structure of the AtaT Y144F mutant toxin bound to the C-terminus of the antitoxin AtaR 0.843 44 235
7chd-assembly4.cif.gz_D AtaT complexed with acetyl-methionyl-tRNAfMet 0.838 44 233
7f36-assembly1.cif.gz_D TacT complexed with acetyl-glycyl-tRNAGly 0.837 46 225
6gtr-assembly2.cif.gz_B Structure of the AtaT Y144F mutant toxin bound to the C-terminus of the antitoxin AtaR and Acetyl-CoA 0.834 44 235
IDDescriptionScoreStartEndSuperfamily
af_Q4D3R5_7_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8685 83 103 3.40.630.30
af_A0A1D6LYK2_621_771_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8551 83 177 3.40.630.30
af_I6XA42_1_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8395 46 227 3.40.630.30
af_Q54R69_211_348_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8312 76 192 3.40.630.30
5fvjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8205 46 222 3.40.630.30
IDDescriptionScoreStartEndGO Terms
AF-A0A255TI47-F1-model_v4 Uncharacterized/unreviewed 0.9266 133 233

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.