Protein Family IF07414

Metagenome Isolate
182 Members
52 Samples
174 Scaffolds
410.88 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_243120|Ga0466712_243120_873_2231
Length
452 aa
Sequence
MNSIRGPDCFPKMRNVRGTVCVKCGAEFEAGNETYTCVNEAGGAKCGGILEIVYDYDYIKTRISRGKFTAGKDFSMWRYLDFLPIEEGSMPGPLRVGWSPLYKTGALGSALGLENLYVKDDGINPTSSLKDRASAIAAARALHAGKDTVACSSTGNAASSLAGAAASMGLKSVIFVPERAPQGKLTQLLIFGATVVSVKGDYGATFRLSAQAIEKYGWYNRNAAVNPYLSEGKKTVAMEIAEQLGLAANGHAAGAFMAPDYVAVSVGDGCTIAGIWKGFKALYAVGLIDRLPRLVSVQAEGCCPVNRAFERNAPIEPMEENTLADSIAVGLPRDGDKALAAIRESGGITVNVSDDEILAAMRLLGKTAGVFGEPAGAAGTAGLAKAAGRGLIPRNSLVVSIVTGNGLKDVASAQRAAGIGGGAIPDSNSESKLLRIEPDIDLLTRELAKLGI

📊 Sample Types

Isolate 4.4%
Metagenome 95.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.2%
Kalotermitidae 27.5%
Unclassified 17.6%
Rhinotermitidae 7.8%
Termopsidae 5.9%

🌳 Taxonomy

Archaea 0
Bacteria 169
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2508501043 Desulfovibrio termitidis HI1 Isolate Rhinotermitidae
26 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
27 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
28 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
38 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
43 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
44 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
50 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
51 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_044863 3300042612 Bacteria 4323
2 Ga0466712_243120 3300042614 Bacteria 4717
3 Ga0466711_041452 3300042615 Bacteria 22315
4 Ga0466711_219283 3300042615 Bacteria 20243
5 Ga0466715_321699 3300042616 Bacteria 15126
6 Ga0466723_107886 3300042618 Bacteria 18885
7 Ga0466723_159151 3300042618 Bacteria 13980
8 Ga0466723_276999 3300042618 Bacteria 14136
9 Ga0466703_028670 3300042636 Bacteria 14961
10 Ga0466707_206182 3300042601 Bacteria 5512
11 Ga0466707_317717 3300042601 Bacteria 48916
12 Ga0466720_049532 3300042607 Bacteria 16419
13 Ga0466690_113881 3300042590 Bacteria 15072
14 Ga0466690_195000 3300042590 Bacteria 11182
15 Ga0466692_000184 3300042591 Unclassified 1669
16 Ga0466692_094700 3300042591 Bacteria 5008
17 Ga0466692_142815 3300042591 Bacteria 3615
18 Ga0466692_196409 3300042591 Bacteria 2369
19 Ga0466695_095830 3300042595 Bacteria 5834
20 Ga0466699_155630 3300042597 Bacteria 2070
21 Ga0466699_164390 3300042597 Bacteria 14924
22 Ga0466699_398284 3300042597 Bacteria 4830
23 JGI24698J34947_10010847 3300002449 Bacteria 4999
24 JGI24702J35022_10078653 3300002462 Bacteria 1785
25 Ga0466732_017777 3300042656 Bacteria 3228
26 Ga0466715_166601 3300042616 Bacteria 13126
27 Ga0466723_088682 3300042618 Bacteria 13386
28 Ga0466723_319968 3300042618 Bacteria 6091
29 Ga0466726_025403 3300042619 Bacteria 17152
30 Ga0466726_444148 3300042619 Bacteria 3219
31 Ga0466728_081288 3300042620 Bacteria 2826
32 Ga0123353_10017783 3300010167 Unclassified 10475
33 Ga0466703_070050 3300042636 Bacteria 14980
34 Ga0466703_222543 3300042636 Bacteria 14737
35 Ga0466708_070372 3300042652 Bacteria 12027
36 Ga0466708_095088 3300042652 Bacteria 1800
37 Ga0466727_037338 3300042655 Bacteria 3864
38 Ga0466700_331081 3300042600 Unclassified 1608
39 Ga0466716_396596 3300042605 Bacteria 4517
40 Ga0466716_424141 3300042605 Bacteria 3857
41 Ga0466719_020532 3300042606 Bacteria 3803
42 Ga0466720_052430 3300042607 Bacteria 2355
43 Ga0415639_119341 3300038395 Bacteria 2080
44 Ga0466690_286953 3300042590 Unclassified 8298
45 Ga0466690_378795 3300042590 Unclassified 1354
46 Ga0466693_247521 3300042592 Bacteria 3085
47 Ga0466699_179119 3300042597 Bacteria 1793
48 JGI24698J34947_10010880 3300002449 Bacteria 4992
49 Ga0466732_411204 3300042656 Bacteria 3042
50 Ga0466712_031862 3300042614 Bacteria 21250
51 Ga0466715_108686 3300042616 Bacteria 11634
52 Ga0466718_103167 3300042617 Bacteria 3678
53 Ga0466728_099334 3300042620 Bacteria 5135
54 Ga0466728_354354 3300042620 Bacteria 1567
55 Ga0466704_334572 3300042643 Bacteria 24393
56 Ga0466709_228776 3300042648 Bacteria 16366
57 Ga0466709_305691 3300042648 Bacteria 3243
58 Ga0466709_384634 3300042648 Unclassified 2816
59 Ga0466716_015282 3300042605 Bacteria 25597
60 Ga0466722_044108 3300042609 Bacteria 5874
61 Ga0466698_026835 3300042610 Bacteria 11996
62 Ga0264413_116939 3300024493 Unclassified 2052
63 Ga0466699_008737 3300042597 Bacteria 5287
64 JGI24698J34947_10000833 3300002449 Bacteria 15450
65 Ga0068302_10002708 3300005071 Bacteria 8857
66 Ga0466705_071877 3300042612 Bacteria 11450
67 Ga0466705_152584 3300042612 Bacteria 12577
68 Ga0466723_210369 3300042618 Bacteria 1570
69 Ga0123357_10003785 3300009784 Bacteria 17504
70 Ga0123354_10164009 3300010882 Unclassified 2622
71 Ga0466703_092583 3300042636 Bacteria 10247
72 Ga0466703_420165 3300042636 Bacteria 9754
73 Ga0466704_422870 3300042643 Bacteria 5440
74 Ga0466716_063392 3300042605 Bacteria 1590
75 Ga0466719_213626 3300042606 Bacteria 1824
76 Ga0466719_328459 3300042606 Bacteria 19533
77 Ga0466720_047098 3300042607 Bacteria 19090
78 Ga0466690_141078 3300042590 Bacteria 12491
79 Ga0466691_045640 3300042593 Bacteria 12384
80 Ga0466694_069539 3300042594 Bacteria 3169
81 Ga0466696_093318 3300042596 Bacteria 14554
82 Ga0466699_195527 3300042597 Bacteria 1649
83 JGI24698J34947_10000603 3300002449 Bacteria 17214
84 Ga0466705_084452 3300042612 Bacteria 9931
85 Ga0466712_202481 3300042614 Bacteria 11457
86 Ga0466711_047694 3300042615 Bacteria 1677
87 Ga0466723_159385 3300042618 Bacteria 4957
88 Ga0466723_295199 3300042618 Bacteria 3586
89 Ga0466723_356130 3300042618 Bacteria 2860
90 Ga0466726_301741 3300042619 Bacteria 15887
91 Ga0466728_239971 3300042620 Bacteria 4204
92 Ga0123353_10328110 3300010167 Unclassified 2318
93 Ga0466703_039800 3300042636 Bacteria 4165
94 Ga0466708_445358 3300042652 Bacteria 8585
95 Ga0466727_156089 3300042655 Bacteria 13935
96 Ga0466713_016528 3300042602 Bacteria 1529
97 Ga0466720_019530 3300042607 Bacteria 2638
98 Ga0466720_089305 3300042607 Bacteria 26279
99 Ga0466692_016073 3300042591 Bacteria 3257
100 Ga0466694_163913 3300042594 Unclassified 2758
101 Ga0466699_147765 3300042597 Bacteria 14099
102 Ga0466699_443303 3300042597 Bacteria 1944
103 AustNasuHG_c1002404 3300000089 Bacteria 6759
104 Ga0466732_039298 3300042656 Bacteria 1545
105 Ga0466712_021806 3300042614 Bacteria 7507
106 Ga0466711_090458 3300042615 Bacteria 2201
107 Ga0466711_510118 3300042615 Bacteria 3897
108 Ga0466715_575004 3300042616 Bacteria 3026
109 Ga0466718_076685 3300042617 Bacteria 2970
110 Ga0466718_129875 3300042617 Bacteria 2696
111 Ga0466726_215024 3300042619 Bacteria 3728
112 Ga0466703_212245 3300042636 Bacteria 15087
113 Ga0466708_075252 3300042652 Bacteria 11056
114 Ga0466727_252663 3300042655 Bacteria 4375
115 Ga0466720_043305 3300042607 Bacteria 11476
116 Ga0466720_179504 3300042607 Bacteria 13268
117 Ga0264413_123934 3300024493 Bacteria 16438
118 Ga0466691_119225 3300042593 Bacteria 2030
119 Ga0466696_211180 3300042596 Unclassified 3935
120 AustNasuHG_c1015385 3300000089 Bacteria 2581
121 Ga0466710_106534 3300042613 Bacteria 1953
122 Ga0466712_075804 3300042614 Bacteria 38150
123 Ga0466711_457952 3300042615 Bacteria 3612
124 Ga0466715_076702 3300042616 Bacteria 6532
125 Ga0466718_069594 3300042617 Bacteria 2943
126 Ga0466718_069806 3300042617 Bacteria 6186
127 Ga0466718_084915 3300042617 Bacteria 13702
128 Ga0466723_079153 3300042618 Bacteria 2335
129 Ga0466723_186396 3300042618 Bacteria 4055
130 Ga0466726_004934 3300042619 Bacteria 1480
131 Ga0466726_449292 3300042619 Bacteria 9398
132 Ga0466728_150093 3300042620 Bacteria 8526
133 Ga0123354_10212369 3300010882 Bacteria 2086
134 Ga0466729_281765 3300042621 Bacteria 1683
135 Ga0466704_574677 3300042643 Bacteria 6735
136 Ga0466727_211017 3300042655 Bacteria 3027
137 Ga0466727_312903 3300042655 Bacteria 3907
138 Ga0466720_082573 3300042607 Unclassified 8384
139 Ga0466720_192283 3300042607 Bacteria 8530
140 Ga0466722_039499 3300042609 Bacteria 2396
141 Ga0466690_002907 3300042590 Unclassified 1982
142 Ga0466692_200914 3300042591 Bacteria 9007
143 JGI24698J34947_10000106 3300002449 Bacteria 28864
144 JGI24698J34947_10005000 3300002449 Bacteria 7266
145 JGI24695J34938_10003954 3300002450 Bacteria 9997
146 JGI24702J35022_10012434 3300002462 Bacteria 4734
147 JGI24700J35501_10930847 3300002508 Bacteria 27907
148 Ga0466705_210081 3300042612 Bacteria 20349
149 Ga0466732_015049 3300042656 Bacteria 8476
150 Ga0466732_427730 3300042656 Bacteria 10803
151 Ga0466712_284256 3300042614 Bacteria 29285
152 Ga0466715_559471 3300042616 Bacteria 1652
153 Ga0466718_100759 3300042617 Bacteria 9859
154 Ga0466723_051952 3300042618 Bacteria 20182
155 Ga0466728_150536 3300042620 Bacteria 4582
156 Ga0466728_464178 3300042620 Bacteria 4032
157 Ga0123353_10088335 3300010167 Bacteria 4992
158 Ga0466704_191460 3300042643 Bacteria 34072
159 Ga0466709_039529 3300042648 Bacteria 1741
160 Ga0466727_294921 3300042655 Bacteria 3915
161 Ga0466713_098869 3300042602 Bacteria 1146
162 Ga0466719_007979 3300042606 Bacteria 14174
163 Ga0466719_120385 3300042606 Bacteria 4252
164 Ga0466720_008850 3300042607 Bacteria 13895
165 Ga0466720_047977 3300042607 Bacteria 1808
166 Ga0466690_428176 3300042590 Bacteria 1812
167 Ga0466692_109815 3300042591 Bacteria 1642
168 Ga0466691_224021 3300042593 Bacteria 6496
169 Ga0466695_040993 3300042595 Bacteria 7954
170 Ga0466696_457311 3300042596 Bacteria 3171
171 Ga0466699_413294 3300042597 Bacteria 25958
172 JGI24698J34947_10000076 3300002449 Bacteria 31759
173 JGI24698J34947_10002790 3300002449 Bacteria 9460
174 Ga0072940_1047982 3300005200 Bacteria 3499

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_075252 Ga0466708_075252_9944_11014 343
2 3300042655 Ga0466727_156089 Ga0466727_156089_1696_2754 344
3 3300042591 Ga0466692_016073 Ga0466692_016073_34_1104 356
4 3300042602 Ga0466713_098869 Ga0466713_098869_30_1100 356
5 3300005200 Ga0072940_1047982 Ga0072940_10479822 359
6 3300042597 Ga0466699_164390 Ga0466699_164390_1711_2886 362
7 3300042605 Ga0466716_015282 Ga0466716_015282_6989_8137 369
8 3300042615 Ga0466711_219283 Ga0466711_219283_12526_13695 370
9 3300042590 Ga0466690_378795 Ga0466690_378795_200_1342 380
10 3300042643 Ga0466704_191460 Ga0466704_191460_10156_11298 380
11 iso_pr_bacteria 2820539610 2820540441 380
12 3300042620 Ga0466728_150093 Ga0466728_150093_5821_7062 384
13 3300042596 Ga0466696_093318 Ga0466696_093318_5712_6953 385
14 3300042617 Ga0466718_069594 Ga0466718_069594_23_1183 386
15 3300042648 Ga0466709_228776 Ga0466709_228776_540_1799 391
16 3300042612 Ga0466705_152584 Ga0466705_152584_6966_8219 392
17 3300042616 Ga0466715_166601 Ga0466715_166601_4787_6043 392
18 3300024493 Ga0264413_116939 Ga0264413_1169392 393
19 3300042606 Ga0466719_007979 Ga0466719_007979_4069_5250 393
20 3300010882 Ga0123354_10164009 Ga0123354_101640091 395
21 3300042618 Ga0466723_210369 Ga0466723_210369_147_1409 396
22 3300042636 Ga0466703_028670 Ga0466703_028670_3988_5235 396
23 3300042652 Ga0466708_095088 Ga0466708_095088_135_1388 396
24 3300042605 Ga0466716_424141 Ga0466716_424141_1542_2798 397
25 3300042617 Ga0466718_129875 Ga0466718_129875_1111_2343 398
26 3300042607 Ga0466720_008850 Ga0466720_008850_815_2071 399
27 3300042620 Ga0466728_081288 Ga0466728_081288_525_1778 399
28 iso_pr_bacteria 2508501043 2508701373 399
29 3300042615 Ga0466711_457952 Ga0466711_457952_2005_3246 400
30 3300042636 Ga0466703_212245 Ga0466703_212245_11620_12861 400
31 iso_pr_bacteria 2989309576 2989310166 400
32 3300042590 Ga0466690_113881 Ga0466690_113881_3213_4454 401
33 3300042596 Ga0466696_211180 Ga0466696_211180_2467_3708 401
34 3300042605 Ga0466716_396596 Ga0466716_396596_1153_2394 401
35 3300042606 Ga0466719_213626 Ga0466719_213626_412_1653 401
36 3300042607 Ga0466720_047977 Ga0466720_047977_408_1664 401
37 3300042616 Ga0466715_559471 Ga0466715_559471_183_1436 401
38 3300042618 Ga0466723_159151 Ga0466723_159151_6689_7930 401
39 3300042619 Ga0466726_444148 Ga0466726_444148_1600_2904 401
40 3300042620 Ga0466728_239971 Ga0466728_239971_771_2012 401
41 3300042648 Ga0466709_305691 Ga0466709_305691_1041_2297 401
42 3300042652 Ga0466708_445358 Ga0466708_445358_2472_3758 401
43 3300042607 Ga0466720_179504 Ga0466720_179504_1239_2501 402
44 3300042617 Ga0466718_076685 Ga0466718_076685_180_1412 402
45 3300024493 Ga0264413_123934 Ga0264413_12393417 403
46 3300042592 Ga0466693_247521 Ga0466693_247521_175_1386 403
47 3300042597 Ga0466699_179119 Ga0466699_179119_313_1524 403
48 3300042643 Ga0466704_422870 Ga0466704_422870_2514_3725 403
49 3300042607 Ga0466720_047098 Ga0466720_047098_584_1852 404
50 3300042636 Ga0466703_092583 Ga0466703_092583_136_1368 404
51 3300042655 Ga0466727_252663 Ga0466727_252663_2149_3456 404
52 3300000089 AustNasuHG_c1002404 AustNasuHG_10024044 405
53 3300000089 AustNasuHG_c1015385 AustNasuHG_10153851 405
54 3300042616 Ga0466715_321699 Ga0466715_321699_9220_10452 405
55 3300042617 Ga0466718_069806 Ga0466718_069806_3306_4574 405
56 3300042618 Ga0466723_088682 Ga0466723_088682_8367_9608 405
57 3300042620 Ga0466728_099334 Ga0466728_099334_850_2091 405
58 3300042620 Ga0466728_464178 Ga0466728_464178_2499_3743 405
59 3300042648 Ga0466709_384634 Ga0466709_384634_490_1731 405
60 3300042606 Ga0466719_020532 Ga0466719_020532_175_1437 406
61 3300042617 Ga0466718_103167 Ga0466718_103167_1420_2697 406
62 3300042619 Ga0466726_004934 Ga0466726_004934_144_1397 406
63 3300042619 Ga0466726_301741 Ga0466726_301741_13171_14415 406
64 3300042656 Ga0466732_427730 Ga0466732_427730_6499_7788 406
65 3300042618 Ga0466723_186396 Ga0466723_186396_1908_3167 407
66 3300042636 Ga0466703_039800 Ga0466703_039800_2331_3602 407
67 3300005071 Ga0068302_10002708 Ga0068302_100027084 408
68 3300042606 Ga0466719_120385 Ga0466719_120385_2324_3586 408
69 3300042607 Ga0466720_192283 Ga0466720_192283_5337_6617 408
70 3300042656 Ga0466732_039298 Ga0466732_039298_92_1318 408
71 3300042607 Ga0466720_052430 Ga0466720_052430_601_1881 409
72 3300042614 Ga0466712_021806 Ga0466712_021806_5973_7280 409
73 3300042618 Ga0466723_159385 Ga0466723_159385_3124_4383 409
74 3300042618 Ga0466723_356130 Ga0466723_356130_1102_2358 409
75 3300042620 Ga0466728_150536 Ga0466728_150536_2283_3542 409
76 3300042656 Ga0466732_411204 Ga0466732_411204_1460_2740 409
77 3300042590 Ga0466690_286953 Ga0466690_286953_1528_2778 410
78 3300042593 Ga0466691_045640 Ga0466691_045640_2381_3613 410
79 3300042601 Ga0466707_317717 Ga0466707_317717_37981_39213 410
80 3300042602 Ga0466713_016528 Ga0466713_016528_160_1419 410
81 3300042606 Ga0466719_328459 Ga0466719_328459_4035_5267 410
82 3300042607 Ga0466720_019530 Ga0466720_019530_301_1572 410
83 3300042607 Ga0466720_049532 Ga0466720_049532_3777_5033 410
84 3300042612 Ga0466705_084452 Ga0466705_084452_3839_5071 410
85 3300042615 Ga0466711_090458 Ga0466711_090458_66_1328 410
86 3300042618 Ga0466723_276999 Ga0466723_276999_11298_12530 410
87 3300042590 Ga0466690_141078 Ga0466690_141078_4326_5591 411
88 3300042590 Ga0466690_195000 Ga0466690_195000_348_1583 411
89 3300042616 Ga0466715_575004 Ga0466715_575004_1716_2951 411
90 3300042618 Ga0466723_051952 Ga0466723_051952_27_1280 411
91 3300042618 Ga0466723_107886 Ga0466723_107886_13067_14332 411
92 3300042619 Ga0466726_215024 Ga0466726_215024_1443_2678 411
93 3300042656 Ga0466732_017777 Ga0466732_017777_1932_3182 411
94 iso_pr_bacteria 2820457604 2820458419 411
95 3300002462 JGI24702J35022_10078653 JGI24702J35022_100786532 412
96 3300010167 Ga0123353_10017783 Ga0123353_100177838 412
97 3300042617 Ga0466718_084915 Ga0466718_084915_3270_4523 412
98 3300042594 Ga0466694_069539 Ga0466694_069539_1706_2989 413
99 3300042597 Ga0466699_147765 Ga0466699_147765_12124_13386 413
100 3300042615 Ga0466711_041452 Ga0466711_041452_579_1820 413
101 3300042619 Ga0466726_025403 Ga0466726_025403_12159_13400 413
102 3300042636 Ga0466703_070050 Ga0466703_070050_6866_8107 413
103 3300042648 Ga0466709_039529 Ga0466709_039529_360_1601 413
104 iso_pr_bacteria 2820535361 2820537146 413
105 3300002449 JGI24698J34947_10000106 JGI24698J34947_1000010622 414
106 3300042596 Ga0466696_457311 Ga0466696_457311_581_1825 414
107 3300042607 Ga0466720_082573 Ga0466720_082573_6536_7798 414
108 3300042609 Ga0466722_039499 Ga0466722_039499_333_1577 414
109 3300042612 Ga0466705_044863 Ga0466705_044863_727_1971 414
110 3300042590 Ga0466690_428176 Ga0466690_428176_275_1522 415
111 3300042597 Ga0466699_008737 Ga0466699_008737_706_1995 415
112 3300042614 Ga0466712_075804 Ga0466712_075804_22341_23630 415
113 3300042616 Ga0466715_108686 Ga0466715_108686_8984_10258 415
114 3300010167 Ga0123353_10328110 Ga0123353_103281102 416
115 3300042597 Ga0466699_155630 Ga0466699_155630_435_1712 416
116 3300042601 Ga0466707_206182 Ga0466707_206182_2634_3884 416
117 3300042609 Ga0466722_044108 Ga0466722_044108_436_1710 416
118 3300042616 Ga0466715_076702 Ga0466715_076702_152_1432 416
119 iso_pr_bacteria 2820418027 2820418321 416
120 3300042597 Ga0466699_195527 Ga0466699_195527_308_1585 417
121 3300042593 Ga0466691_224021 Ga0466691_224021_1490_2746 418
122 3300042597 Ga0466699_413294 Ga0466699_413294_714_1985 418
123 3300042610 Ga0466698_026835 Ga0466698_026835_669_1940 418
124 3300042612 Ga0466705_210081 Ga0466705_210081_1657_2913 418
125 3300042643 Ga0466704_334572 Ga0466704_334572_20064_21320 418
126 3300042600 Ga0466700_331081 Ga0466700_331081_308_1597 419
127 3300042605 Ga0466716_063392 Ga0466716_063392_153_1412 419
128 3300042614 Ga0466712_031862 Ga0466712_031862_13648_14907 419
129 3300042618 Ga0466723_079153 Ga0466723_079153_194_1453 419
130 3300042620 Ga0466728_354354 Ga0466728_354354_116_1375 419
131 3300042621 Ga0466729_281765 Ga0466729_281765_112_1410 419
132 3300042636 Ga0466703_222543 Ga0466703_222543_69_1364 419
133 3300042590 Ga0466690_002907 Ga0466690_002907_601_1911 420
134 3300042597 Ga0466699_398284 Ga0466699_398284_2791_4071 420
135 3300042615 Ga0466711_047694 Ga0466711_047694_155_1417 420
136 3300042615 Ga0466711_510118 Ga0466711_510118_2375_3637 420
137 3300042655 Ga0466727_211017 Ga0466727_211017_1568_2845 420
138 3300042591 Ga0466692_000184 Ga0466692_000184_163_1473 421
139 3300042595 Ga0466695_095830 Ga0466695_095830_1421_2686 421
140 3300042612 Ga0466705_071877 Ga0466705_071877_3194_4459 421
141 3300002449 JGI24698J34947_10000603 JGI24698J34947_100006038 422
142 3300042591 Ga0466692_142815 Ga0466692_142815_104_1372 422
143 3300042591 Ga0466692_200914 Ga0466692_200914_1482_2750 422
144 3300042619 Ga0466726_449292 Ga0466726_449292_2658_3926 422
145 3300042655 Ga0466727_312903 Ga0466727_312903_2049_3317 422
146 3300042591 Ga0466692_094700 Ga0466692_094700_271_1542 423
147 3300042591 Ga0466692_109815 Ga0466692_109815_316_1587 423
148 3300042656 Ga0466732_015049 Ga0466732_015049_5841_7130 423
149 3300002449 JGI24698J34947_10000076 JGI24698J34947_1000007624 424
150 3300042655 Ga0466727_037338 Ga0466727_037338_669_1943 424
151 iso_pr_bacteria 2819994798 2819997813 424
152 3300002449 JGI24698J34947_10010847 JGI24698J34947_100108474 425
153 3300002508 JGI24700J35501_10930847 JGI24700J35501_109308475 425
154 3300042597 Ga0466699_443303 Ga0466699_443303_153_1430 425
155 3300042607 Ga0466720_089305 Ga0466720_089305_1077_2393 425
156 3300042614 Ga0466712_284256 Ga0466712_284256_20308_21603 425
157 3300002449 JGI24698J34947_10010880 JGI24698J34947_100108804 426
158 3300042655 Ga0466727_294921 Ga0466727_294921_1672_2952 426
159 3300010882 Ga0123354_10212369 Ga0123354_102123692 427
160 3300042594 Ga0466694_163913 Ga0466694_163913_67_1353 428
161 3300042618 Ga0466723_319968 Ga0466723_319968_322_1611 429
162 3300042593 Ga0466691_119225 Ga0466691_119225_293_1588 431
163 iso_pr_bacteria 2781125651 2781309741 433
164 3300002449 JGI24698J34947_10000833 JGI24698J34947_100008337 434
165 3300002449 JGI24698J34947_10002790 JGI24698J34947_100027903 434
166 3300002449 JGI24698J34947_10005000 JGI24698J34947_100050004 434
167 3300002450 JGI24695J34938_10003954 JGI24695J34938_100039542 434
168 3300038395 Ga0415639_119341 Ga0415639_119341_85_1389 434
169 3300042591 Ga0466692_196409 Ga0466692_196409_816_2123 435
170 3300042617 Ga0466718_100759 Ga0466718_100759_1204_2514 436
171 3300042643 Ga0466704_574677 Ga0466704_574677_3194_4570 437
172 3300042614 Ga0466712_202481 Ga0466712_202481_6915_8249 438
173 3300042595 Ga0466695_040993 Ga0466695_040993_6464_7807 439
174 3300042613 Ga0466710_106534 Ga0466710_106534_176_1519 440
175 3300009784 Ga0123357_10003785 Ga0123357_100037852 441
176 3300010167 Ga0123353_10088335 Ga0123353_100883352 441
177 3300042618 Ga0466723_295199 Ga0466723_295199_562_1929 442
178 3300042652 Ga0466708_070372 Ga0466708_070372_6033_7400 442
179 3300002462 JGI24702J35022_10012434 JGI24702J35022_100124342 443
180 3300042607 Ga0466720_043305 Ga0466720_043305_9232_10590 444
181 3300042614 Ga0466712_243120 Ga0466712_243120_873_2231 452
182 3300042636 Ga0466703_420165 Ga0466703_420165_2302_3690 462

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00291 PALP Pyridoxal-phosphate dependent enzyme 96 404 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.