Protein Family IF07370
Metagenome
Isolate
122
Members
34
Samples
116
Scaffolds
263.18
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_107367|Ga0466712_107367_23_988
- Length
- 321 aa
- Sequence
- MSQFHDDPGKFLPFVFQIVQRGSDKNVVLHPFKYTEIQAKKQQEVMDDTRKVSYYKGMIGFLIRKTFYDLWDNMFRIVLLNLGFIVSLTIPIILPGYIPIPLLSIAVAAIGVFWCFIYLAAVALSLKAVSDYGVFGLADFKANLKAGWPAGVVMGLASFIFFLILRVIIPFYLDMNSLVGLLLGAVIFWTLILALVSFQFFFAIRARLDTKPIKIIKKCFIIFFDNPGFSIFSLLYTLATLVVSLIFALLLPGPAGLLLFLDEGLRLRLMKYDWLETVSQDNPPTAGPPRRRSIPWDALLIEEREKTGTRTFRNFIFPWKD
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.9%
Kalotermitidae
21.9%
Unclassified
18.8%
Rhinotermitidae
6.2%
Termopsidae
3.1%
Hodotermitidae
3.1%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 7 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 24 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 29 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 30 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_036167 | 3300042614 | Bacteria | 7811 |
| 2 | Ga0466712_177037 | 3300042614 | Bacteria | 13458 |
| 3 | Ga0466706_051278 | 3300042599 | Bacteria | 5447 |
| 4 | JGI24698J34947_10008698 | 3300002449 | Bacteria | 5568 |
| 5 | JGI24698J34947_10011067 | 3300002449 | Bacteria | 4950 |
| 6 | Ga0415639_067572 | 3300038395 | Bacteria | 6125 |
| 7 | Ga0466692_158349 | 3300042591 | Bacteria | 8545 |
| 8 | Ga0466699_066186 | 3300042597 | Bacteria | 10023 |
| 9 | Ga0466699_119184 | 3300042597 | Bacteria | 1172 |
| 10 | Ga0466699_128402 | 3300042597 | Bacteria | 2537 |
| 11 | Ga0466699_170042 | 3300042597 | Unclassified | 3541 |
| 12 | Ga0466699_194310 | 3300042597 | Bacteria | 4382 |
| 13 | Ga0123353_10023541 | 3300010167 | Bacteria | 9328 |
| 14 | Ga0466712_152695 | 3300042614 | Bacteria | 3324 |
| 15 | Ga0466712_267773 | 3300042614 | Bacteria | 21070 |
| 16 | Ga0466723_149854 | 3300042618 | Bacteria | 25559 |
| 17 | Ga0466726_376447 | 3300042619 | Bacteria | 2311 |
| 18 | Ga0466703_115999 | 3300042636 | Bacteria | 10851 |
| 19 | Ga0466703_404262 | 3300042636 | Bacteria | 2715 |
| 20 | Ga0466716_039686 | 3300042605 | Bacteria | 5099 |
| 21 | Ga0466722_080852 | 3300042609 | Bacteria | 4461 |
| 22 | Ga0466698_200599 | 3300042610 | Bacteria | 3122 |
| 23 | JGI24698J34947_10021981 | 3300002449 | Bacteria | 3425 |
| 24 | JGI24698J34947_10024205 | 3300002449 | Bacteria | 3243 |
| 25 | JGI24698J34947_10033698 | 3300002449 | Bacteria | 2684 |
| 26 | JGI24698J34947_10040215 | 3300002449 | Bacteria | 2416 |
| 27 | JGI24698J34947_10067834 | 3300002449 | Bacteria | 1728 |
| 28 | Ga0072941_1020126 | 3300005201 | Bacteria | 7605 |
| 29 | Ga0072941_1132511 | 3300005201 | Bacteria | 3266 |
| 30 | Ga0264413_100902 | 3300024493 | Bacteria | 9959 |
| 31 | Ga0466690_001515 | 3300042590 | Bacteria | 6015 |
| 32 | Ga0466694_167475 | 3300042594 | Bacteria | 1305 |
| 33 | Ga0466699_002237 | 3300042597 | Bacteria | 1366 |
| 34 | Ga0466699_247444 | 3300042597 | Bacteria | 1026 |
| 35 | Ga0466699_350745 | 3300042597 | Bacteria | 3284 |
| 36 | Ga0466733_181624 | 3300042659 | Bacteria | 1569 |
| 37 | Ga0123356_11083984 | 3300010049 | Bacteria | 970 |
| 38 | Ga0466712_257815 | 3300042614 | Bacteria | 3545 |
| 39 | Ga0466712_300761 | 3300042614 | Unclassified | 2086 |
| 40 | Ga0466703_235569 | 3300042636 | Bacteria | 46354 |
| 41 | JGI24698J34947_10130385 | 3300002449 | Bacteria | 1075 |
| 42 | JGI24695J34938_10086926 | 3300002450 | Bacteria | 1286 |
| 43 | Ga0264413_100901 | 3300024493 | Bacteria | 9484 |
| 44 | Ga0466699_261022 | 3300042597 | Bacteria | 2852 |
| 45 | Ga0466712_076495 | 3300042614 | Bacteria | 3240 |
| 46 | Ga0466712_107367 | 3300042614 | Bacteria | 1067 |
| 47 | Ga0466718_018052 | 3300042617 | Bacteria | 14407 |
| 48 | Ga0466698_406437 | 3300042610 | Bacteria | 1965 |
| 49 | Ga0466698_472613 | 3300042610 | Bacteria | 1374 |
| 50 | JGI24698J34947_10017559 | 3300002449 | Bacteria | 3876 |
| 51 | JGI24695J34938_10004315 | 3300002450 | Bacteria | 9368 |
| 52 | Ga0072941_1000636 | 3300005201 | Bacteria | 15567 |
| 53 | Ga0072941_1036046 | 3300005201 | Bacteria | 5327 |
| 54 | Ga0264413_100823 | 3300024493 | Bacteria | 13465 |
| 55 | Ga0466692_185030 | 3300042591 | Bacteria | 1605 |
| 56 | Ga0466694_194136 | 3300042594 | Bacteria | 8525 |
| 57 | Ga0123356_10316729 | 3300010049 | Bacteria | 1671 |
| 58 | Ga0466712_256048 | 3300042614 | Bacteria | 11462 |
| 59 | Ga0466704_035661 | 3300042643 | Bacteria | 27042 |
| 60 | Ga0466720_090987 | 3300042607 | Bacteria | 2494 |
| 61 | Ga0466720_092177 | 3300042607 | Bacteria | 42147 |
| 62 | Ga0466720_222968 | 3300042607 | Bacteria | 1502 |
| 63 | Ga0466722_256973 | 3300042609 | Bacteria | 13522 |
| 64 | Ga0466698_164009 | 3300042610 | Bacteria | 3717 |
| 65 | JGI24698J34947_10027707 | 3300002449 | Bacteria | 3005 |
| 66 | JGI24698J34947_10087724 | 3300002449 | Bacteria | 1438 |
| 67 | JGI24695J34938_10089251 | 3300002450 | Bacteria | 1266 |
| 68 | JGI24699J35502_11089180 | 3300002509 | Unclassified | 2104 |
| 69 | Ga0072941_1010098 | 3300005201 | Bacteria | 12642 |
| 70 | Ga0466691_104861 | 3300042593 | Bacteria | 10770 |
| 71 | Ga0466694_051126 | 3300042594 | Bacteria | 14193 |
| 72 | Ga0466699_430776 | 3300042597 | Bacteria | 1879 |
| 73 | Ga0466732_283217 | 3300042656 | Bacteria | 1234 |
| 74 | Ga0466712_186347 | 3300042614 | Bacteria | 7417 |
| 75 | Ga0466712_198456 | 3300042614 | Bacteria | 11385 |
| 76 | Ga0466712_296815 | 3300042614 | Bacteria | 1738 |
| 77 | Ga0466702_115944 | 3300042635 | Bacteria | 1439 |
| 78 | Ga0466704_018726 | 3300042643 | Bacteria | 1440 |
| 79 | Ga0466720_174806 | 3300042607 | Bacteria | 5581 |
| 80 | Ga0466722_116166 | 3300042609 | Bacteria | 1711 |
| 81 | JGI24698J34947_10002227 | 3300002449 | Bacteria | 10387 |
| 82 | JGI24698J34947_10006439 | 3300002449 | Bacteria | 6445 |
| 83 | JGI24698J34947_10008769 | 3300002449 | Bacteria | 5545 |
| 84 | JGI24698J34947_10012931 | 3300002449 | Bacteria | 4561 |
| 85 | JGI24698J34947_10013655 | 3300002449 | Bacteria | 4427 |
| 86 | JGI24698J34947_10034545 | 3300002449 | Bacteria | 2645 |
| 87 | JGI24695J34938_10004008 | 3300002450 | Bacteria | 9911 |
| 88 | JGI24695J34938_10007162 | 3300002450 | Bacteria | 6584 |
| 89 | Ga0466690_355312 | 3300042590 | Bacteria | 7657 |
| 90 | Ga0466694_388893 | 3300042594 | Unclassified | 6678 |
| 91 | Ga0466699_068649 | 3300042597 | Bacteria | 5893 |
| 92 | Ga0466699_176225 | 3300042597 | Bacteria | 16865 |
| 93 | Ga0123356_10000767 | 3300010049 | Bacteria | 35460 |
| 94 | Ga0123356_10290631 | 3300010049 | Bacteria | 1735 |
| 95 | Ga0466712_227295 | 3300042614 | Bacteria | 3692 |
| 96 | Ga0466718_022003 | 3300042617 | Bacteria | 1453 |
| 97 | Ga0466719_022775 | 3300042606 | Unclassified | 3743 |
| 98 | JGI24698J34947_10006874 | 3300002449 | Bacteria | 6252 |
| 99 | JGI24698J34947_10008788 | 3300002449 | Bacteria | 5540 |
| 100 | JGI24698J34947_10048638 | 3300002449 | Bacteria | 2146 |
| 101 | JGI24695J34938_10002059 | 3300002450 | Bacteria | 15814 |
| 102 | JGI24695J34938_10007887 | 3300002450 | Bacteria | 6159 |
| 103 | Ga0072941_1041944 | 3300005201 | Bacteria | 7016 |
| 104 | Ga0466691_021978 | 3300042593 | Unclassified | 3898 |
| 105 | Ga0466694_286262 | 3300042594 | Bacteria | 1056 |
| 106 | Ga0466699_124485 | 3300042597 | Bacteria | 3863 |
| 107 | Ga0466699_171801 | 3300042597 | Bacteria | 13472 |
| 108 | Ga0466699_195529 | 3300042597 | Bacteria | 8358 |
| 109 | Ga0466732_068350 | 3300042656 | Bacteria | 9443 |
| 110 | Ga0466712_050157 | 3300042614 | Bacteria | 1963 |
| 111 | Ga0466712_123419 | 3300042614 | Bacteria | 7915 |
| 112 | Ga0466704_450996 | 3300042643 | Bacteria | 30662 |
| 113 | Ga0466720_071556 | 3300042607 | Bacteria | 10684 |
| 114 | JGI24698J34947_10045442 | 3300002449 | Bacteria | 2241 |
| 115 | JGI24695J34938_10000631 | 3300002450 | Bacteria | 33552 |
| 116 | Ga0466694_232366 | 3300042594 | Bacteria | 2637 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042593 | Ga0466691_021978 | Ga0466691_021978_697_1470 | 217 |
| 2 | 3300042636 | Ga0466703_235569 | Ga0466703_235569_11278_12051 | 217 |
| 3 | 3300042643 | Ga0466704_450996 | Ga0466704_450996_170_943 | 217 |
| 4 | 3300042618 | Ga0466723_149854 | Ga0466723_149854_12086_12859 | 221 |
| 5 | 3300042606 | Ga0466719_022775 | Ga0466719_022775_908_1681 | 233 |
| 6 | 3300042597 | Ga0466699_119184 | Ga0466699_119184_24_797 | 241 |
| 7 | 3300042614 | Ga0466712_177037 | Ga0466712_177037_5659_6393 | 244 |
| 8 | 3300042607 | Ga0466720_092177 | Ga0466720_092177_9002_9784 | 247 |
| 9 | 3300005201 | Ga0072941_1132511 | Ga0072941_11325113 | 252 |
| 10 | 3300042590 | Ga0466690_001515 | Ga0466690_001515_5018_5791 | 257 |
| 11 | 3300042593 | Ga0466691_104861 | Ga0466691_104861_9200_9973 | 257 |
| 12 | 3300042597 | Ga0466699_066186 | Ga0466699_066186_76_849 | 257 |
| 13 | 3300042597 | Ga0466699_128402 | Ga0466699_128402_567_1340 | 257 |
| 14 | 3300042597 | Ga0466699_261022 | Ga0466699_261022_1063_1836 | 257 |
| 15 | 3300042605 | Ga0466716_039686 | Ga0466716_039686_4013_4786 | 257 |
| 16 | 3300042609 | Ga0466722_116166 | Ga0466722_116166_494_1267 | 257 |
| 17 | 3300042614 | Ga0466712_296815 | Ga0466712_296815_579_1430 | 257 |
| 18 | 3300042614 | Ga0466712_300761 | Ga0466712_300761_623_1432 | 257 |
| 19 | 3300042619 | Ga0466726_376447 | Ga0466726_376447_1177_1950 | 257 |
| 20 | 3300042643 | Ga0466704_035661 | Ga0466704_035661_264_1037 | 257 |
| 21 | 3300042656 | Ga0466732_283217 | Ga0466732_283217_205_978 | 257 |
| 22 | 3300042659 | Ga0466733_181624 | Ga0466733_181624_663_1436 | 257 |
| 23 | 3300002449 | JGI24698J34947_10040215 | JGI24698J34947_100402153 | 258 |
| 24 | 3300002450 | JGI24695J34938_10002059 | JGI24695J34938_100020595 | 258 |
| 25 | 3300002509 | JGI24699J35502_11089180 | JGI24699J35502_110891802 | 258 |
| 26 | 3300010167 | Ga0123353_10023541 | Ga0123353_100235412 | 258 |
| 27 | 3300042594 | Ga0466694_232366 | Ga0466694_232366_988_1806 | 258 |
| 28 | 3300042609 | Ga0466722_256973 | Ga0466722_256973_12543_13337 | 258 |
| 29 | 3300042614 | Ga0466712_256048 | Ga0466712_256048_1116_1892 | 258 |
| 30 | 3300042614 | Ga0466712_267773 | Ga0466712_267773_9094_9870 | 258 |
| 31 | 3300002449 | JGI24698J34947_10013655 | JGI24698J34947_100136552 | 259 |
| 32 | 3300002449 | JGI24698J34947_10033698 | JGI24698J34947_100336983 | 259 |
| 33 | 3300042597 | Ga0466699_170042 | Ga0466699_170042_540_1370 | 259 |
| 34 | 3300042636 | Ga0466703_404262 | Ga0466703_404262_1611_2390 | 259 |
| 35 | 3300042643 | Ga0466704_018726 | Ga0466704_018726_202_981 | 259 |
| 36 | 3300002450 | JGI24695J34938_10089251 | JGI24695J34938_100892512 | 260 |
| 37 | 3300042591 | Ga0466692_158349 | Ga0466692_158349_7507_8289 | 260 |
| 38 | 3300042594 | Ga0466694_051126 | Ga0466694_051126_2414_3196 | 260 |
| 39 | 3300042594 | Ga0466694_194136 | Ga0466694_194136_7410_8192 | 260 |
| 40 | 3300042594 | Ga0466694_388893 | Ga0466694_388893_462_1244 | 260 |
| 41 | 3300042597 | Ga0466699_171801 | Ga0466699_171801_3430_4212 | 260 |
| 42 | 3300042597 | Ga0466699_350745 | Ga0466699_350745_1925_2707 | 260 |
| 43 | 3300042597 | Ga0466699_430776 | Ga0466699_430776_928_1710 | 260 |
| 44 | 3300042607 | Ga0466720_071556 | Ga0466720_071556_2386_3168 | 260 |
| 45 | 3300042614 | Ga0466712_036167 | Ga0466712_036167_4964_5782 | 260 |
| 46 | 3300042614 | Ga0466712_123419 | Ga0466712_123419_2604_3386 | 260 |
| 47 | 3300042614 | Ga0466712_152695 | Ga0466712_152695_2269_3087 | 260 |
| 48 | 3300042614 | Ga0466712_186347 | Ga0466712_186347_2502_3284 | 260 |
| 49 | 3300042614 | Ga0466712_198456 | Ga0466712_198456_5415_6197 | 260 |
| 50 | 3300042614 | Ga0466712_257815 | Ga0466712_257815_1186_1968 | 260 |
| 51 | 3300042617 | Ga0466718_018052 | Ga0466718_018052_3033_3815 | 260 |
| 52 | 3300042635 | Ga0466702_115944 | Ga0466702_115944_127_909 | 260 |
| 53 | iso_pr_bacteria | 2781125658 | 2781324844 | 260 |
| 54 | iso_pr_bacteria | 2819990093 | 2819990126 | 260 |
| 55 | 3300002449 | JGI24698J34947_10002227 | JGI24698J34947_100022273 | 261 |
| 56 | 3300002449 | JGI24698J34947_10006874 | JGI24698J34947_100068745 | 261 |
| 57 | 3300002449 | JGI24698J34947_10087724 | JGI24698J34947_100877242 | 261 |
| 58 | 3300038395 | Ga0415639_067572 | Ga0415639_067572_1479_2264 | 261 |
| 59 | 3300042597 | Ga0466699_002237 | Ga0466699_002237_173_958 | 261 |
| 60 | 3300042597 | Ga0466699_124485 | Ga0466699_124485_1018_1803 | 261 |
| 61 | 3300042597 | Ga0466699_194310 | Ga0466699_194310_303_1088 | 261 |
| 62 | 3300042597 | Ga0466699_247444 | Ga0466699_247444_217_1002 | 261 |
| 63 | 3300042610 | Ga0466698_164009 | Ga0466698_164009_2372_3181 | 261 |
| 64 | iso_pr_bacteria | 2781125648 | 2781305797 | 261 |
| 65 | 3300002450 | JGI24695J34938_10004008 | JGI24695J34938_100040084 | 262 |
| 66 | 3300002450 | JGI24695J34938_10004315 | JGI24695J34938_100043158 | 262 |
| 67 | 3300002450 | JGI24695J34938_10007887 | JGI24695J34938_100078876 | 262 |
| 68 | 3300002450 | JGI24695J34938_10086926 | JGI24695J34938_100869262 | 262 |
| 69 | 3300005201 | Ga0072941_1000636 | Ga0072941_100063615 | 262 |
| 70 | 3300005201 | Ga0072941_1041944 | Ga0072941_10419444 | 262 |
| 71 | 3300042597 | Ga0466699_068649 | Ga0466699_068649_3357_4196 | 262 |
| 72 | 3300042597 | Ga0466699_195529 | Ga0466699_195529_3301_4140 | 262 |
| 73 | 3300042607 | Ga0466720_222968 | Ga0466720_222968_224_1012 | 262 |
| 74 | 3300010049 | Ga0123356_11083984 | Ga0123356_110839841 | 263 |
| 75 | 3300002449 | JGI24698J34947_10011067 | JGI24698J34947_100110675 | 264 |
| 76 | 3300002449 | JGI24698J34947_10021981 | JGI24698J34947_100219814 | 264 |
| 77 | 3300005201 | Ga0072941_1010098 | Ga0072941_10100985 | 264 |
| 78 | 3300042607 | Ga0466720_090987 | Ga0466720_090987_491_1285 | 264 |
| 79 | 3300042610 | Ga0466698_406437 | Ga0466698_406437_812_1606 | 264 |
| 80 | 3300002449 | JGI24698J34947_10012931 | JGI24698J34947_100129313 | 265 |
| 81 | 3300002449 | JGI24698J34947_10067834 | JGI24698J34947_100678342 | 265 |
| 82 | 3300042591 | Ga0466692_185030 | Ga0466692_185030_190_987 | 265 |
| 83 | 3300042597 | Ga0466699_176225 | Ga0466699_176225_3555_4352 | 265 |
| 84 | 3300042610 | Ga0466698_472613 | Ga0466698_472613_60_857 | 265 |
| 85 | 3300042614 | Ga0466712_050157 | Ga0466712_050157_544_1341 | 265 |
| 86 | iso_pr_bacteria | 2781125687 | 2781420821 | 265 |
| 87 | 3300002449 | JGI24698J34947_10006439 | JGI24698J34947_100064396 | 266 |
| 88 | 3300005201 | Ga0072941_1020126 | Ga0072941_10201269 | 266 |
| 89 | 3300042594 | Ga0466694_167475 | Ga0466694_167475_72_872 | 266 |
| 90 | 3300042594 | Ga0466694_286262 | Ga0466694_286262_76_876 | 266 |
| 91 | 3300042614 | Ga0466712_227295 | Ga0466712_227295_406_1206 | 266 |
| 92 | 3300002449 | JGI24698J34947_10048638 | JGI24698J34947_100486382 | 267 |
| 93 | 3300002449 | JGI24698J34947_10130385 | JGI24698J34947_101303851 | 267 |
| 94 | 3300010049 | Ga0123356_10000767 | Ga0123356_1000076719 | 267 |
| 95 | 3300002449 | JGI24698J34947_10045442 | JGI24698J34947_100454422 | 270 |
| 96 | 3300042590 | Ga0466690_355312 | Ga0466690_355312_2320_3240 | 271 |
| 97 | 3300024493 | Ga0264413_100902 | Ga0264413_1009024 | 272 |
| 98 | 3300042617 | Ga0466718_022003 | Ga0466718_022003_156_974 | 272 |
| 99 | iso_pr_bacteria | 2781125651 | 2781310080 | 272 |
| 100 | 3300002450 | JGI24695J34938_10007162 | JGI24695J34938_100071627 | 273 |
| 101 | 3300042656 | Ga0466732_068350 | Ga0466732_068350_8364_9185 | 273 |
| 102 | 3300002449 | JGI24698J34947_10034545 | JGI24698J34947_100345452 | 274 |
| 103 | 3300002449 | JGI24698J34947_10008788 | JGI24698J34947_100087883 | 275 |
| 104 | 3300010049 | Ga0123356_10316729 | Ga0123356_103167292 | 275 |
| 105 | 3300042609 | Ga0466722_080852 | Ga0466722_080852_3623_4450 | 275 |
| 106 | 3300010049 | Ga0123356_10290631 | Ga0123356_102906312 | 276 |
| 107 | 3300024493 | Ga0264413_100823 | Ga0264413_10082312 | 276 |
| 108 | 3300042607 | Ga0466720_174806 | Ga0466720_174806_3644_4474 | 276 |
| 109 | 3300002449 | JGI24698J34947_10008698 | JGI24698J34947_100086985 | 277 |
| 110 | 3300005201 | Ga0072941_1036046 | Ga0072941_10360464 | 277 |
| 111 | 3300024493 | Ga0264413_100901 | Ga0264413_1009012 | 277 |
| 112 | 3300002450 | JGI24695J34938_10000631 | JGI24695J34938_100006318 | 279 |
| 113 | 3300042610 | Ga0466698_200599 | Ga0466698_200599_1452_2294 | 280 |
| 114 | 3300002449 | JGI24698J34947_10017559 | JGI24698J34947_100175594 | 283 |
| 115 | 3300042599 | Ga0466706_051278 | Ga0466706_051278_1696_2547 | 283 |
| 116 | 3300042614 | Ga0466712_076495 | Ga0466712_076495_972_1823 | 283 |
| 117 | 3300002449 | JGI24698J34947_10024205 | JGI24698J34947_100242053 | 284 |
| 118 | 3300002449 | JGI24698J34947_10027707 | JGI24698J34947_100277073 | 284 |
| 119 | 3300042636 | Ga0466703_115999 | Ga0466703_115999_4546_5415 | 289 |
| 120 | 3300002449 | JGI24698J34947_10008769 | JGI24698J34947_100087694 | 292 |
| 121 | iso_pr_bacteria | 2781125644 | 2781296403 | 303 |
| 122 | 3300042614 | Ga0466712_107367 | Ga0466712_107367_23_988 | 321 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.76 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.