Protein Family IF07349

Metagenome Isolate
128 Members
65 Samples
107 Scaffolds
178.05 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_053296|Ga0466712_053296_380_1000
Length
206 aa
Sequence
MLVVRYYATFGKFLNNDFILGDKKLSRIGKKPVSIPSEAKIDYKEGQITVKGPKGELSINVHPNIDLKIENNEIVVSRKSELKKDKALHGLYRALINNLIIGVTNGFTRKLEIVGVGFRAEMKGAMVQLSLGFSHPILFIPPNNIKLETPTPNSILISGISKELVGMVASKIRMLRPPEPYKGKGIKYEGEVIRRKAGKAASKSLK

📊 Sample Types

Isolate 16.4%
Metagenome 83.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.9%
Unclassified 20.3%
Kalotermitidae 18.6%
Rhinotermitidae 5.1%
Blattidae 5.1%
Drosophilidae 5.1%
Termopsidae 3.4%
Passalidae 3.4%
Hodotermitidae 1.7%
Bombycidae 1.7%
Apidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2898741527 Sphingobacterium sp. xlx-73 Isolate
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 8017489919 Lactobacillus brevis EF Isolate Unclassified
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
10 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
11 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
12 2820034764 Unclassified Saccharibacteria Nt197P3bin119 Isolate Unclassified
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2896321640 Sphingobacterium sp. xlx-130 Isolate
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
30 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
31 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
32 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
33 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
34 2820030936 Unclassified Saccharibacteria Th196P3bin64 Isolate Unclassified
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 2896350215 Sphingobacterium sp. xlx-183 Isolate
38 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 2896330536 Sphingobacterium sp. xlx-96 Isolate
54 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
55 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
56 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
57 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
58 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
59 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
60 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
61 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
62 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
63 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
64 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
65 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_350326 3300042612 Bacteria 8976
2 2227078861 2225789003 Unclassified 2073
3 2227524734 2225789004 Bacteria 651
4 Ga0072940_1231968 3300005200 Bacteria 3438
5 Ga0466735_052282 3300042624 Bacteria 1113
6 Ga0466703_296238 3300042636 Bacteria 15890
7 Ga0466719_341563 3300042606 Unclassified 1104
8 Ga0466721_020381 3300042608 Bacteria 2082
9 Ga0466692_073917 3300042591 Bacteria 4685
10 Ga0466696_132837 3300042596 Bacteria 1301
11 Ga0123355_11130624 3300009826 Bacteria 810
12 Ga0123355_11838910 3300009826 Bacteria 569
13 Ga0123356_10462282 3300010049 Bacteria 1419
14 Ga0466697_151463 3300042611 Bacteria 1976
15 Ga0466705_003139 3300042612 Bacteria 1436
16 Ga0466705_352406 3300042612 Bacteria 5590
17 JGI24695J34938_10007117 3300002450 Bacteria 6611
18 Ga0466702_070590 3300042635 Bacteria 1727
19 Ga0466702_298567 3300042635 Bacteria 1646
20 Ga0466704_317456 3300042643 Bacteria 9810
21 Ga0466711_096823 3300042615 Unclassified 7679
22 Ga0466723_302750 3300042618 Bacteria 42513
23 Ga0466707_343529 3300042601 Bacteria 1285
24 Ga0466719_138491 3300042606 Bacteria 13763
25 Ga0466722_183422 3300042609 Bacteria 24688
26 Ga0123355_10062669 3300009826 Bacteria 6001
27 Ga0466705_220327 3300042612 Bacteria 34237
28 Ga0104045_1027826 3300007085 Bacteria 6019
29 Ga0466703_060128 3300042636 Bacteria 9641
30 Ga0466703_173416 3300042636 Bacteria 9442
31 Ga0466724_53803 3300042649 Bacteria 7886
32 Ga0466725_310051 3300042654 Bacteria 1784
33 Ga0466710_419232 3300042613 Bacteria 6782
34 Ga0466711_331423 3300042615 Bacteria 21624
35 Ga0466700_003116 3300042600 Bacteria 1871
36 Ga0466719_544594 3300042606 Bacteria 47826
37 Ga0123355_10755658 3300009826 Bacteria 1098
38 Ga0123356_10020898 3300010049 Bacteria 6193
39 Ga0123356_10176966 3300010049 Bacteria 2151
40 Ga0123353_11303708 3300010167 Bacteria 943
41 Ga0123353_11834492 3300010167 Bacteria 752
42 2227469069 2225789004 Bacteria 24169
43 Ga0466729_215447 3300042621 Bacteria 1523
44 Ga0466718_058750 3300042617 Bacteria 21157
45 Ga0466728_440827 3300042620 Bacteria 1251
46 Ga0466716_282117 3300042605 Bacteria 10451
47 Ga0123355_10731936 3300009826 Bacteria 1125
48 Ga0123356_10519975 3300010049 Bacteria 1348
49 Ga0123356_11363185 3300010049 Bacteria 871
50 Ga0123353_10005941 3300010167 Bacteria 16150
51 JGI24702J35022_10000321 3300002462 Bacteria 28517
52 Ga0466715_301768 3300042616 Bacteria 11970
53 Ga0466728_453851 3300042620 Bacteria 38332
54 Ga0466706_042181 3300042599 Bacteria 2557
55 Ga0466713_077596 3300042602 Bacteria 70669
56 Ga0264413_147249 3300024493 Bacteria 7272
57 Ga0466692_191285 3300042591 Bacteria 67075
58 Ga0466693_438251 3300042592 Bacteria 1230
59 Ga0466696_050110 3300042596 Bacteria 23714
60 Ga0123356_10002433 3300010049 Bacteria 19910
61 Ga0123356_10730209 3300010049 Bacteria 1160
62 Ga0123356_11692871 3300010049 Bacteria 784
63 Ga0123354_10001196 3300010882 Bacteria 30578
64 Ga0104019_1005811 3300007150 Bacteria 5660
65 Ga0466708_025071 3300042652 Bacteria 34065
66 Ga0466725_035929 3300042654 Bacteria 3676
67 Ga0466727_184302 3300042655 Bacteria 1756
68 Ga0466710_352868 3300042613 Bacteria 1186
69 Ga0466707_100238 3300042601 Bacteria 32835
70 Ga0466722_064483 3300042609 Bacteria 235903
71 Ga0415639_128633 3300038395 Bacteria 13811
72 Ga0123355_10243613 3300009826 Unclassified 2543
73 Ga0123356_10005813 3300010049 Bacteria 12520
74 Ga0123356_10567888 3300010049 Unclassified 1297
75 Ga0466704_234724 3300042643 Bacteria 9934
76 Ga0466704_469129 3300042643 Bacteria 8635
77 Ga0466725_083172 3300042654 Bacteria 1168
78 Ga0466712_053296 3300042614 Bacteria 1430
79 Ga0466711_473339 3300042615 Bacteria 4144
80 Ga0466718_056817 3300042617 Bacteria 2909
81 Ga0466707_146364 3300042601 Bacteria 1121
82 Ga0466717_141665 3300042604 Unclassified 1094
83 Ga0466717_219026 3300042604 Unclassified 1165
84 Ga0466696_406730 3300042596 Bacteria 1128
85 Ga0123356_10642863 3300010049 Bacteria 1228
86 Ga0123353_10996495 3300010167 Bacteria 1126
87 Ga0123353_11536254 3300010167 Bacteria 845
88 Ga0466705_033815 3300042612 Bacteria 8087
89 Ga0072940_1132958 3300005200 Bacteria 3644
90 Ga0466703_214606 3300042636 Bacteria 2698
91 Ga0466708_041708 3300042652 Bacteria 26213
92 Ga0466725_310578 3300042654 Bacteria 1019
93 Ga0466705_421116 3300042612 Unclassified 2952
94 Ga0466712_145106 3300042614 Unclassified 1518
95 Ga0466715_131933 3300042616 Bacteria 43814
96 Ga0466723_137051 3300042618 Bacteria 11974
97 Ga0466717_214640 3300042604 Bacteria 1319
98 Ga0466717_281118 3300042604 Bacteria 2515
99 Ga0466719_023899 3300042606 Unclassified 1888
100 Ga0466719_177114 3300042606 Bacteria 2501
101 Ga0466722_215646 3300042609 Bacteria 2106
102 Ga0466694_221694 3300042594 Bacteria 1332
103 Ga0123355_10006032 3300009826 Bacteria 17860
104 Ga0123355_10051982 3300009826 Unclassified 6649
105 Ga0123356_10001507 3300010049 Bacteria 25614
106 Ga0123353_10000175 3300010167 Bacteria 81609
107 Ga0123354_10010812 3300010882 Bacteria 14085

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_544594 Ga0466719_544594_22850_23386 150
2 3300042592 Ga0466693_438251 Ga0466693_438251_653_1192 154
3 3300002450 JGI24695J34938_10007117 JGI24695J34938_100071175 160
4 3300042636 Ga0466703_060128 Ga0466703_060128_1670_2209 160
5 3300042618 Ga0466723_137051 Ga0466723_137051_2063_2596 161
6 3300042612 Ga0466705_421116 Ga0466705_421116_1089_1628 162
7 3300042636 Ga0466703_173416 Ga0466703_173416_1114_1611 165
8 3300010049 Ga0123356_10176966 Ga0123356_101769663 168
9 3300038395 Ga0415639_128633 Ga0415639_128633_7292_7828 168
10 3300042606 Ga0466719_023899 Ga0466719_023899_862_1401 169
11 3300042606 Ga0466719_138491 Ga0466719_138491_862_1401 169
12 3300009826 Ga0123355_10051982 Ga0123355_100519826 170
13 3300009826 Ga0123355_11838910 Ga0123355_118389101 170
14 3300010049 Ga0123356_10567888 Ga0123356_105678882 170
15 3300010049 Ga0123356_10642863 Ga0123356_106428633 170
16 3300042601 Ga0466707_146364 Ga0466707_146364_458_997 170
17 3300010167 Ga0123353_11303708 Ga0123353_113037081 171
18 3300010049 Ga0123356_10002433 Ga0123356_1000243319 173
19 3300042605 Ga0466716_282117 Ga0466716_282117_2103_2624 173
20 3300042604 Ga0466717_219026 Ga0466717_219026_351_875 174
21 3300042617 Ga0466718_058750 Ga0466718_058750_12576_13100 174
22 3300042591 Ga0466692_191285 Ga0466692_191285_13971_14501 176
23 3300042596 Ga0466696_050110 Ga0466696_050110_12396_12926 176
24 3300042609 Ga0466722_215646 Ga0466722_215646_930_1460 176
25 3300042612 Ga0466705_350326 Ga0466705_350326_5294_5824 176
26 3300042617 Ga0466718_056817 Ga0466718_056817_2271_2801 176
27 3300042621 Ga0466729_215447 Ga0466729_215447_438_968 176
28 3300042591 Ga0466692_073917 Ga0466692_073917_656_1189 177
29 3300042596 Ga0466696_132837 Ga0466696_132837_401_934 177
30 3300042599 Ga0466706_042181 Ga0466706_042181_419_952 177
31 3300042604 Ga0466717_141665 Ga0466717_141665_439_972 177
32 3300042606 Ga0466719_177114 Ga0466719_177114_693_1226 177
33 3300042609 Ga0466722_064483 Ga0466722_064483_165797_166330 177
34 3300042612 Ga0466705_033815 Ga0466705_033815_3352_3885 177
35 3300042612 Ga0466705_352406 Ga0466705_352406_2196_2729 177
36 3300042615 Ga0466711_096823 Ga0466711_096823_3542_4075 177
37 3300042636 Ga0466703_214606 Ga0466703_214606_1746_2279 177
38 3300042654 Ga0466725_310578 Ga0466725_310578_405_938 177
39 iso_pr_bacteria 2820030936 2820031347 177
40 iso_pr_bacteria 2820034764 2820035376 177
41 3300042611 Ga0466697_151463 Ga0466697_151463_312_848 178
42 3300042618 Ga0466723_302750 Ga0466723_302750_23560_24096 178
43 3300042620 Ga0466728_440827 Ga0466728_440827_626_1162 178
44 iso_pr_bacteria 2896843662 2896846370 178
45 iso_pr_bacteria 2956928875 2956929473 178
46 iso_pr_bacteria 8017489919 8017490801 178
47 2225789004 2227524734 2228031632 179
48 3300010049 Ga0123356_10001507 Ga0123356_1000150722 179
49 3300010049 Ga0123356_10005813 Ga0123356_1000581319 179
50 3300010167 Ga0123353_10005941 Ga0123353_1000594114 179
51 3300042596 Ga0466696_406730 Ga0466696_406730_30_569 179
52 3300042601 Ga0466707_100238 Ga0466707_100238_4511_5050 179
53 3300042601 Ga0466707_343529 Ga0466707_343529_431_970 179
54 3300042602 Ga0466713_077596 Ga0466713_077596_55181_55720 179
55 3300042606 Ga0466719_341563 Ga0466719_341563_488_1027 179
56 3300042609 Ga0466722_183422 Ga0466722_183422_10941_11480 179
57 3300042612 Ga0466705_003139 Ga0466705_003139_19_558 179
58 3300042615 Ga0466711_331423 Ga0466711_331423_10558_11097 179
59 3300042615 Ga0466711_473339 Ga0466711_473339_579_1118 179
60 3300042616 Ga0466715_131933 Ga0466715_131933_22044_22583 179
61 3300042616 Ga0466715_301768 Ga0466715_301768_8948_9487 179
62 3300042620 Ga0466728_453851 Ga0466728_453851_22721_23260 179
63 3300042636 Ga0466703_296238 Ga0466703_296238_10185_10724 179
64 3300042643 Ga0466704_317456 Ga0466704_317456_5985_6524 179
65 3300042652 Ga0466708_025071 Ga0466708_025071_19764_20303 179
66 3300042652 Ga0466708_041708 Ga0466708_041708_15916_16455 179
67 3300042655 Ga0466727_184302 Ga0466727_184302_505_1044 179
68 iso_pr_bacteria 2820831444 2820832555 179
69 iso_pr_bacteria 2820935937 2820939569 179
70 iso_pr_bacteria 2940241992 2940242217 179
71 iso_pr_bacteria 2940349480 2940349706 179
72 3300005200 Ga0072940_1231968 Ga0072940_12319683 180
73 3300009826 Ga0123355_10062669 Ga0123355_100626698 180
74 3300009826 Ga0123355_10243613 Ga0123355_102436135 180
75 3300009826 Ga0123355_10731936 Ga0123355_107319362 180
76 3300009826 Ga0123355_11130624 Ga0123355_111306241 180
77 3300010049 Ga0123356_10519975 Ga0123356_105199753 180
78 3300010049 Ga0123356_10730209 Ga0123356_107302092 180
79 3300010049 Ga0123356_11363185 Ga0123356_113631851 180
80 3300010049 Ga0123356_11692871 Ga0123356_116928711 180
81 3300042594 Ga0466694_221694 Ga0466694_221694_65_607 180
82 3300042604 Ga0466717_214640 Ga0466717_214640_728_1270 180
83 3300042604 Ga0466717_281118 Ga0466717_281118_1434_1976 180
84 3300042608 Ga0466721_020381 Ga0466721_020381_390_932 180
85 3300042613 Ga0466710_419232 Ga0466710_419232_4787_5329 180
86 3300042654 Ga0466725_035929 Ga0466725_035929_2446_2988 180
87 3300042654 Ga0466725_083172 Ga0466725_083172_152_694 180
88 3300042654 Ga0466725_310051 Ga0466725_310051_914_1456 180
89 iso_pr_bacteria 2820231849 2820232450 180
90 iso_pr_bacteria 2820318056 2820318721 180
91 iso_pr_bacteria 2820405014 2820405309 180
92 iso_pr_bacteria 2820800812 2820800938 180
93 3300002462 JGI24702J35022_10000321 JGI24702J35022_1000032127 181
94 3300005200 Ga0072940_1132958 Ga0072940_11329583 181
95 3300009826 Ga0123355_10006032 Ga0123355_1000603222 181
96 3300009826 Ga0123355_10755658 Ga0123355_107556582 181
97 3300010049 Ga0123356_10462282 Ga0123356_104622822 181
98 3300010167 Ga0123353_10996495 Ga0123353_109964953 181
99 3300010167 Ga0123353_11536254 Ga0123353_115362542 181
100 3300010167 Ga0123353_11834492 Ga0123353_118344922 181
101 3300010882 Ga0123354_10001196 Ga0123354_1000119633 181
102 3300010882 Ga0123354_10010812 Ga0123354_100108128 181
103 3300042635 Ga0466702_298567 Ga0466702_298567_975_1520 181
104 2225789003 2227078861 2227446044 182
105 2225789004 2227469069 2227912059 182
106 3300010049 Ga0123356_10020898 Ga0123356_1002089810 182
107 3300024493 Ga0264413_147249 Ga0264413_14724914 182
108 3300042614 Ga0466712_145106 Ga0466712_145106_471_1019 182
109 3300042635 Ga0466702_070590 Ga0466702_070590_910_1458 182
110 3300042613 Ga0466710_352868 Ga0466710_352868_519_1070 183
111 iso_pr_bacteria 2636416028 2638994528 183
112 3300042649 Ga0466724_53803 Ga0466724_53803_6365_6919 184
113 iso_pr_bacteria 2509276035 2509457238 184
114 iso_pr_bacteria 2579779088 2582239294 184
115 iso_pr_bacteria 2896321640 2896323933 184
116 iso_pr_bacteria 2896330536 2896332502 184
117 iso_pr_bacteria 2896350215 2896352314 184
118 iso_pr_bacteria 2898741527 2898744284 184
119 3300007085 Ga0104045_1027826 Ga0104045_102782611 185
120 3300007150 Ga0104019_1005811 Ga0104019_10058115 185
121 3300042600 Ga0466700_003116 Ga0466700_003116_919_1476 185
122 3300042612 Ga0466705_220327 Ga0466705_220327_21679_22236 185
123 3300042624 Ga0466735_052282 Ga0466735_052282_362_919 185
124 3300042643 Ga0466704_234724 Ga0466704_234724_9186_9743 185
125 3300042643 Ga0466704_469129 Ga0466704_469129_5024_5581 185
126 iso_pr_bacteria 2940373808 2940377004 185
127 3300010167 Ga0123353_10000175 Ga0123353_1000017532 186
128 3300042614 Ga0466712_053296 Ga0466712_053296_380_1000 206

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00347 Ribosomal_L6 Ribosomal protein L6 114 188 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.